Property Summary

NCBI Gene PubMed Count 27
Grant Count 13
R01 Count 7
Funding $679,680.35
PubMed Score 25.57
PubTator Score 21.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
malignant mesothelioma -1.100 0.000

 GO Function (1)

Gene RIF (6)

PMID Text
25002403 PEX16 mediates the peroxisomal trafficking of two distinct peroxisomal membrane proteins, PEX3 and PMP34, via the endoplasmic reticulum
21768384 Data show that knockdown of Sec16B but not Sec16A by RNAi affected the morphology of peroxisomes, inhibited the transport of Pex16 from the ER to peroxisomes, and suppressed expression of Pex3.
20647552 An unusual variant peroxisome biogenesis disorder caused by mutations in the PEX16 gene, with a relatively mild clinical phenotype and an unexpected phenotype in fibroblasts, was identified.
16717127 PEX16 regulates peroxisome assembly by being cotranslationally inserted into the ER and serving to recruit other peroxisomal membrane proteins to membranes.
12223482 Pex16p functions in peroxisome membrane assembly, more likely upstream of Pex3p
11890679 aberrant splicing mutation of the PEX16 gene in patients with Zellweger syndrome

AA Sequence

MEKLRLLGLRYQEYVTRHPAATAQLETAVRGFSYLLAGRFADSHELSELVYSASNLLVLLNDGILRKELR      1 - 70
KKLPVSLSQQKLLTWLSVLECVEVFMEMGAAKVWGEVGRWLVIALVQLAKAVLRMLLLLWFKAGLQTSPP     71 - 140
IVPLDRETQAQPPDGDHSPGNHEQSYVGKRSNRVVRTLQNTPSLHSRHWGAPQQREGRQQQHHEELSATP    141 - 210
TPLGLQETIAEFLYIARPLLHLLSLGLWGQRSWKPWLLAGVVDVTSLSLLSDRKGLTRRERRELRRRTIL    211 - 280
LLYYLLRSPFYDRFSEARILFLLQLLADHVPGVGLVTRPLMDYLPTWQKIYFYSWG                  281 - 336
//

Publication (28)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25002403 2014 PEX16 contributes to peroxisome maintenance by constantly trafficking PEX3 via the ER.
24144296 2013 Nine loci for ocular axial length identified through genome-wide association studies, including shared loci with refractive error.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21768384 2011 Sec16B is involved in the endoplasmic reticulum export of the peroxisomal membrane biogenesis factor peroxin 16 (Pex16) in mammalian cells.
21525035 2011 PEX14 is required for microtubule-based peroxisome motility in human cells.
20647552 2010 Identification of an unusual variant peroxisome biogenesis disorder caused by mutations in the PEX16 gene.
20531392 2010 The peroxisomal receptor Pex19p forms a helical mPTS recognition domain.
19946888 2010 Defining the membrane proteome of NK cells.
More...