Property Summary

NCBI Gene PubMed Count 58
Grant Count 39
R01 Count 11
Funding $4,343,514.3
PubMed Score 249.51
PubTator Score 184.79

Knowledge Summary

Patent (42,938)

Expression

  Differential Expression (2)

Disease log2 FC p
adult high grade glioma -1.100 0.001
psoriasis -1.500 0.000

Gene RIF (55)

PMID Text
26482433 Hypermethylation of the selected markers (MAL, PRIMA1, PTGDR and SFRP1) can result in reduced gene expression and may contribute to the formation of colorectal cancer.
26194547 Altered expression of chemoattractant CRTH2 on blood basophils and eosinophils in patients with chronic spontaneous urticaria
25850654 smaller proportion of group 2 innate lymphoid cells isolated from nondiseased human lung expressed CRTH2
24929001 Data indicate that in ulcerative colitis, DP2 receptor showed higher expression in neutrophils but lower in monocytes, and CRTH2 receptor was decreased in eosinophils, NK, and CD3(+) T cells but not in monocytes and CD3(+)/CD4(+) T cells.
24922638 Low DP2 prostanoid receptor is associated with gastric cancer progression.
23226366 CRTH2 is not expressed on human amniocytes or myocytes and plays no role in the mechanism of 15dPGJ2-mediated inhibition of NF-kappaB
23168411 Confocal images and FACS demonstrated a strong association and co-localization between VIP peptide and CRTH2 molecules
22947041 CRTh2 rs533116 was associated with allergic asthma in White people
22705147 These data show that prostaglandin D(2) induces human osteoclast apoptosis through activation of CRTH2 and the apoptosis intrinsic pathway.
22627365 we show that CRTH2+ CD4+ T cells may be involved in the enhanced Th2 cell-mediated immunity in IgG4-related lacrimal gland enlargement.
More...

AA Sequence

MSANATLKPLCPILEQMSRLQSHSNTSIRYIDHAAVLLHGLASLLGLVENGVILFVVGCRMRQTVVTTWV      1 - 70
LHLALSDLLASASLPFFTYFLAVGHSWELGTTFCKLHSSIFFLNMFASGFLLSAISLDRCLQVVRPVWAQ     71 - 140
NHRTVAAAHKVCLVLWALAVLNTVPYFVFRDTISRLDGRIMCYYNVLLLNPGPDRDATCNSRQVALAVSK    141 - 210
FLLAFLVPLAIIASSHAAVSLRLQHRGRRRPGRFVRLVAAVVAAFALCWGPYHVFSLLEARAHANPGLRP    211 - 280
LVWRGLPFVTSLAFFNSVANPVLYVLTCPDMLRKLRRSLRTVLESVLVDDSELGGAGSSRRRRTSSTARS    281 - 350
ASPLALCSRPEEPRGPARLLGWLLGSCAASPQTGPLNRALSSTSS                             351 - 395
//

Text Mined References (64)

PMID Year Title
26482433 2015 DNA hypermethylation and decreased mRNA expression of MAL, PRIMA1, PTGDR and SFRP1 in colorectal adenoma and cancer.
26194547 2016 Altered expression of chemoattractant receptor-homologous molecule expressed on T(H)2 cells on blood basophils and eosinophils in patients with chronic spontaneous urticaria.
25850654 2015 The prostaglandin D? receptor CRTH2 regulates accumulation of group 2 innate lymphoid cells in the inflamed lung.
24929001 2014 Opposing roles of prostaglandin D2 receptors in ulcerative colitis.
24922638 2014 The role of type D prostanoid receptors and PPAR? in gastric cancer progression.
23226366 2012 Chemoattractant receptor homologous to the T helper 2 cell (CRTH2) is not expressed in human amniocytes and myocytes.
23168411 2013 Novel association between vasoactive intestinal peptide and CRTH2 receptor in recruiting eosinophils: a possible biochemical mechanism for allergic eosinophilic inflammation of the airways.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22947041 2012 The single nucleotide polymorphism CRTh2 rs533116 is associated with allergic asthma and increased expression of CRTh2.
22705147 2012 Prostaglandin D2 induces apoptosis of human osteoclasts by activating the CRTH2 receptor and the intrinsic apoptosis pathway.
More...