Property Summary

NCBI Gene PubMed Count 8
Grant Count 1
Funding $115,300
PubMed Score 8.15
PubTator Score 7.01

Knowledge Summary

Patent (2,214)

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
diabetes mellitus 1,663

Expression

  Differential Expression (1)

Disease log2 FC p
diabetes mellitus 1.200 0.001

Synonym

Accession Q9Y5Y3 Q6NWS4 Q6NXU6
Symbols PSP24
PSP24A
PSP24(ALPHA)

Gene

PANTHER Protein Class (2)

 Grant Application (1)

  TechDev Info (1)

AA Sequence

MACNSTSLEAYTYLLLNTSNASDSGSTQLPAPLRISLAIVMLLMTVVGFLGNTVVCIIVYQRPAMRSAIN      1 - 70
LLLATLAFSDIMLSLCCMPFTAVTLITVRWHFGDHFCRLSATLYWFFVLEGVAILLIISVDRFLIIVQRQ     71 - 140
DKLNPRRAKVIIAVSWVLSFCIAGPSLTGWTLVEVPARAPQCVLGYTELPADRAYVVTLVVAVFFAPFGV    141 - 210
MLCAYMCILNTVRKNAVRVHNQSDSLDLRQLTRAGLRRLQRQQQVSVDLSFKTKAFTTILILFVGFSLCW    211 - 280
LPHSVYSLLSVFSQRFYCGSSFYATSTCVLWLSYLKSVFNPIVYCWRIKKFREACIELLPQTFQILPKVP    281 - 350
ERIRRRIQPSTVYVCNENQSAV                                                    351 - 372
//

Publication (9)

PMID Year Title
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11027575 2000 Mammalian PSP24s (alpha and beta isoforms) are not responsive to lysophosphatidic acid in mammalian expression systems.
11027574 2000 Brain-specific expression of novel G-protein-coupled receptors, with homologies to Xenopus PSP24 and human GPR45.
10036181 1999 Discovery of three novel orphan G-protein-coupled receptors.