Property Summary

NCBI Gene PubMed Count 16
PubMed Score 32.05
PubTator Score 8.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Neuroblastoma 80 4.434 2.2

Expression

Gene RIF (4)

AA Sequence

MEAAAEPGNLAGVRHIILVLSGKGGVGKSTISTELALALRHAGKKVGILDVDLCGPSIPRMLGAQGRAVH      1 - 70
QCDRGWAPVFLDREQSISLMSVGFLLEKPDEAVVWRGPKKNALIKQFVSDVAWGELDYLVVDTPPGTSDE     71 - 140
HMATIEALRPYQPLGALVVTTPQAVSVGDVRRELTFCRKTGLRVMGIVENMSGFTCPHCTECTSVFSRGG    141 - 210
GEELAQLAGVPFLGSVPLDPALMRTLEEGHDFIQEFPGSPAFAALTSIAQKILDATPACLP             211 - 271
//

Text Mined References (21)

PMID Year Title