Property Summary

NCBI Gene PubMed Count 32
PubMed Score 33.76
PubTator Score 123.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
POSTERIOR COLUMN ATAXIA WITH RETINITIS PIGMENTOSA 1 0.0 0.0
Disease Target Count Z-score Confidence
Neurodegenerative disease 414 0.0 4.0
Neuropathy 261 0.0 4.0
Disease Target Count Z-score Confidence
Age related macular degeneration 1 4 4.498 2.2
Anemia 365 3.068 1.5

Expression

  Differential Expression (14)

Disease log2 FC p
adrenocortical carcinoma 1.232 3.2e-02
Breast cancer 1.200 2.6e-09
breast carcinoma 1.100 4.5e-05
ductal carcinoma in situ 1.800 3.9e-03
group 3 medulloblastoma 1.900 2.0e-04
intraductal papillary-mucinous adenoma (... 1.500 2.8e-02
intraductal papillary-mucinous carcinoma... 1.400 3.2e-02
invasive ductal carcinoma 1.400 8.3e-03
lung carcinoma 1.900 1.9e-31
medulloblastoma, large-cell 1.200 1.6e-02
nasopharyngeal carcinoma 1.300 1.1e-03
osteosarcoma -1.428 3.4e-03
primitive neuroectodermal tumor 1.300 9.7e-03
ulcerative colitis -1.300 3.1e-05

Gene RIF (15)

AA Sequence

MARPDDEEGAAVAPGHPLAKGYLPLPRGAPVGKESVELQNGPKAGTFPVNGAPRDSLAAASGVLGGPQTP      1 - 70
LAPEEETQARLLPAGAGAETPGAESSPLPLTALSPRRFVVLLIFSLYSLVNAFQWIQYSIISNVFEGFYG     71 - 140
VTLLHIDWLSMVYMLAYVPLIFPATWLLDTRGLRLTALLGSGLNCLGAWIKCGSVQQHLFWVTMLGQCLC    141 - 210
SVAQVFILGLPSRIASVWFGPKEVSTACATAVLGNQLGTAVGFLLPPVLVPNTQNDTNLLACNISTMFYG    211 - 280
TSAVATLLFILTAIAFKEKPRYPPSQAQAALQDSPPEEYSYKKSIRNLFKNIPFVLLLITYGIMTGAFYS    281 - 350
VSTLLNQMILTYYEGEEVNAGRIGLTLVVAGMVGSILCGLWLDYTKTYKQTTLIVYILSFIGMVIFTFTL    351 - 420
DLRYIIIVFVTGGVLGFFMTGYLPLGFEFAVEITYPESEGTSSGLLNASAQIFGILFTLAQGKLTSDYGP    421 - 490
KAGNIFLCVWMFIGIILTALIKSDLRRHNINIGITNVDVKAIPADSPTDQEPKTVMLSKQSESAI         491 - 555
//

Text Mined References (38)

PMID Year Title