Property Summary

NCBI Gene PubMed Count 30
Grant Count 39
R01 Count 19
Funding $4,171,149.75
PubMed Score 30.63
PubTator Score 123.54

Knowledge Summary

Patent

No data available

Expression

Gene RIF (13)

PMID Text
26067085 Data shows that FLVCR1a participates in the control of intestinal mucosa homeostasis by exporting the excess of de novo synthesized heme from intestinal cells.
25795718 Flvcr1 regulates differentiation of erythroid progenitors by controlling intracellular heme accumulation.
24576667 both HIF2alpha and ETS1 are involved in the transcriptional regulation of Flvcr1a and that HIF2alpha is absolutely required for Flvcr1a induction upon hypoxia
23187127 FLVCR1b regulates erythropoiesis by controlling mitochondrial heme efflux, whereas FLVCR1a expression is required to prevent hemorrhages and edema.
22483575 FLVCR1 mutants failed to fold properly in the ER, were rapidly degraded in the lysosomes, and therefore, could not export heme out of cells. Thus, accumulation of heme in FLVCR1-mutant cells could cause cellular toxicity.
22279524 Study identified sequence variants in the known disease-causing genes SLC6A3 and FLVCR1, and present evidence to strongly support the pathogenicity of variants identified in TUBGCP6, BRAT1, SNIP1, CRADD, and HARS.
21593354 relative protein expression of 2 heme transporters, Feline Leukemia Virus, Subgroup C, Receptor 1 (FLVCR1) and Breast Cancer Resistance Protein, was assessed in placental tissue in relation to maternal/neonatal iron status and placental iron concentration
21267618 Posterior column ataxia with retinitis pigmentosa is caused by mutations in FLVCR1.
21070897 These results suggest that aberrant FLVCR1 causes a selective degeneration of a subpopulation of neurons in the retina and the posterior columns of the spinal cord via dysregulation of heme or iron homeostasis.
20610401 hemopexin directly interacts with FLVCR
More...

AA Sequence

MARPDDEEGAAVAPGHPLAKGYLPLPRGAPVGKESVELQNGPKAGTFPVNGAPRDSLAAASGVLGGPQTP      1 - 70
LAPEEETQARLLPAGAGAETPGAESSPLPLTALSPRRFVVLLIFSLYSLVNAFQWIQYSIISNVFEGFYG     71 - 140
VTLLHIDWLSMVYMLAYVPLIFPATWLLDTRGLRLTALLGSGLNCLGAWIKCGSVQQHLFWVTMLGQCLC    141 - 210
SVAQVFILGLPSRIASVWFGPKEVSTACATAVLGNQLGTAVGFLLPPVLVPNTQNDTNLLACNISTMFYG    211 - 280
TSAVATLLFILTAIAFKEKPRYPPSQAQAALQDSPPEEYSYKKSIRNLFKNIPFVLLLITYGIMTGAFYS    281 - 350
VSTLLNQMILTYYEGEEVNAGRIGLTLVVAGMVGSILCGLWLDYTKTYKQTTLIVYILSFIGMVIFTFTL    351 - 420
DLRYIIIVFVTGGVLGFFMTGYLPLGFEFAVEITYPESEGTSSGLLNASAQIFGILFTLAQGKLTSDYGP    421 - 490
KAGNIFLCVWMFIGIILTALIKSDLRRHNINIGITNVDVKAIPADSPTDQEPKTVMLSKQSESAI         491 - 555
//

Text Mined References (36)

PMID Year Title
26067085 2015 Crucial Role of FLVCR1a in the Maintenance of Intestinal Heme Homeostasis.
25795718 2015 The heme exporter Flvcr1 regulates expansion and differentiation of committed erythroid progenitors by controlling intracellular heme accumulation.
24576667 2014 Hypoxia controls Flvcr1 gene expression in Caco2 cells through HIF2? and ETS1.
23187127 2012 The mitochondrial heme exporter FLVCR1b mediates erythroid differentiation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22483575 2012 Mutations of FLVCR1 in posterior column ataxia and retinitis pigmentosa result in the loss of heme export activity.
22279524 2012 Genetic mapping and exome sequencing identify variants associated with five novel diseases.
21593354 2011 Placental expression of the heme transporter, feline leukemia virus subgroup C receptor, is related to maternal iron status in pregnant adolescents.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21267618 2011 Posterior column ataxia with retinitis pigmentosa in a Japanese family with a novel mutation in FLVCR1.
More...