Property Summary

NCBI Gene PubMed Count 112
Grant Count 65
R01 Count 33
Funding $7,673,174.33
PubMed Score 186.17
PubTator Score 154.14

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9Y5X9 B0LPG6 Q6P9C8 Q6UW82
Symbols EL
EDL
PRO719

Gene

PANTHER Protein Class (2)

Gene RIF (97)

PMID Text
27045898 FoxA1, FoxA2, and LIPG control the uptake of extracellular lipids for breast cancer growth.
26124511 results suggested that the SNP -384A/C in the LIPG gene may be associated with risk for coronary artery disease(CAD)and the LIPG gene may play a role in CAD in the Han Chinese
25291260 EL-384A/C polymorphism was significantly associated with the ACS and lipids profile in an elderly Uygur population in Xinjiang.
25250890 Results showed that the protein levels of endothelial lipase (EL), NF-kappaB p65, MAPK p38 protein levels, in addition to the proliferation of umbilical vein endothelial cells (HUVECs), were increased by angiotensin II (AngII).
24886585 The results of the present meta-analysis suggest that the carriers of EL 584 T allele have a higher HDL-C level in Caucasian populations. Whereas, it might not be a protective factor for CHD.
24852509 Studied if a specific variant of the endothelial lipase gene was more specifically linked to the severity of diabetic retinopathy.
24634127 Genetic studies of patients with early onset of coronary artery disease (CAD) in the Chinese Han population show that the EL 584C/T variant is not always involved in the pathogenesis of early-onset CAD.
24458708 EL activity was higher in metabolic syndrome and in obesity. It was negatively associated with high-density lipoprotein-cholesterol and apolipoprotein A-I in control and metabolic syndrome, respectively.
24115033 Interleukin-6 stimulates the translocation of HDL through the endothelium, the first step in reverse cholesterol transport pathway, by enhancing EL expression.
23991054 Results indicate the spatial consensus catalytic triad "Ser-Asp-His", a characteristic motif in lipoprotein lipase, hepatic lipase, and endothelial lipase.
More...

AA Sequence

MSNSVPLLCFWSLCYCFAAGSPVPFGPEGRLEDKLHKPKATQTEVKPSVRFNLRTSKDPEHEGCYLSVGH      1 - 70
SQPLEDCSFNMTAKTFFIIHGWTMSGIFENWLHKLVSALHTREKDANVVVVDWLPLAHQLYTDAVNNTRV     71 - 140
VGHSIARMLDWLQEKDDFSLGNVHLIGYSLGAHVAGYAGNFVKGTVGRITGLDPAGPMFEGADIHKRLSP    141 - 210
DDADFVDVLHTYTRSFGLSIGIQMPVGHIDIYPNGGDFQPGCGLNDVLGSIAYGTITEVVKCEHERAVHL    211 - 280
FVDSLVNQDKPSFAFQCTDSNRFKKGICLSCRKNRCNSIGYNAKKMRNKRNSKMYLKTRAGMPFRVYHYQ    281 - 350
MKIHVFSYKNMGEIEPTFYVTLYGTNADSQTLPLEIVERIEQNATNTFLVYTEEDLGDLLKIQLTWEGAS    351 - 420
QSWYNLWKEFRSYLSQPRNPGRELNIRRIRVKSGETQRKLTFCTEDPENTSISPGRELWFRKCRDGWRMK    421 - 490
NETSPTVELP                                                                491 - 500
//

Publication (113)

PMID Year Title
27045898 2016 FoxA and LIPG endothelial lipase control the uptake of extracellular lipids for breast cancer growth.
26124511 2015 Association of endothelial lipase gene-384A/C with coronary artery disease in Han Chinese people.
25291260 2014 Endothelial lipase-384A/C polymorphism is associated with acute coronary syndrome and lipid status in elderly Uygur patients in Xinjiang.
25250890 2014 Angiotensin II upregulates endothelial lipase expression via the NF-kappa B and MAPK signaling pathways.
24886585 2014 The associations between endothelial lipase 584C/T polymorphism and HDL-C level and coronary heart disease susceptibility: a meta-analysis.
24852509 2014 Association of endothelial lipase Thr111Ile polymorphism with proliferative retinopathy in type 2 diabetes patients.
24816252 2014 An atlas of genetic influences on human blood metabolites.
24634127 2014 Lack of association between a common polymorphism of the endothelial lipase gene and early-onset coronary artery disease in a Chinese Han population.
24458708 2014 Role of SN1 lipases on plasma lipids in metabolic syndrome and obesity.
24115033 2013 Interleukin 6 stimulates endothelial binding and transport of high-density lipoprotein through induction of endothelial lipase.
More...