Property Summary

NCBI Gene PubMed Count 23
Grant Count 4
R01 Count 2
Funding $266,467.2
PubMed Score 34.98
PubTator Score 31.31

Knowledge Summary

Patent (8,335)


  Disease Relevance (3)


  Differential Expression (1)

Disease log2 FC p
interstitial cystitis -1.100 0.006


Accession Q9Y5X5 Q96RV1 Q9NR49
Symbols GPR74


PANTHER Protein Class (2)

  TechDev Info (1)

Gene RIF (14)

26211894 Effects of systematic N-terminus deletions and benzoylations of endogenous RF-amide peptides on NPFF1R, NPFF2R, GPR10, GPR54 and GPR103.
25326382 The NPFF2 neuropeptide FF receptor phosphorylation sites have been mapped and their role identified in receptor regulation.
22375000 These data show that NPFF-induced heterologous desensitization of MOP receptor signaling is mediated by GRK2 and could involve transphosphorylation within the heteromeric receptor complex.
21818152 Four genetic loci were strongly and independently associated with obesity, NPY2R, NPFFR2, MC4R, and FTO.
20600636 Besides regulation of reproduction, kisspeptins have a potential to mediate physiological effects on autonomic regulation and nociception in humans via the NPFF2R pathways.
19944730 species-related differences in the binding properties of NPFF(2) receptors
18565622 we identified hFF2 positive neurons in the forebrain and medulla oblongata of individuals who died suddenly.
17503329 Observational study of gene-disease association. (HuGE Navigator)
17503329 findings suggest that a common haplotype in the GPR74 gene protects against obesity, which, in part, is caused by a relief of inhibition of lipid mobilization from adipose tissue
17157836 NPFF system may also have species-specific features since the NPFF2 receptor mRNA expression differs from that reported for rat

AA Sequence

HGETLLYRKSAEKPQQELVMEELKETTNSSEI                                          491 - 522

Text Mined References (23)

PMID Year Title
26211894 2015 Effects of systematic N-terminus deletions and benzoylations of endogenous RF-amide peptides on NPFF1R, NPFF2R, GPR10, GPR54 and GPR103.
25326382 2014 Identification and functional characterization of the phosphorylation sites of the neuropeptide FF2 receptor.
22375000 2012 GRK2 protein-mediated transphosphorylation contributes to loss of function of ?-opioid receptors induced by neuropeptide FF (NPFF2) receptors.
21818152 2011 Polymorphisms in the NPY2R gene show significant associations with BMI that are additive to FTO, MC4R, and NPFFR2 gene effects.
20600636 2010 Human kisspeptins activate neuropeptide FF2 receptor.
19944730 2010 Pharmacological characterization of the mouse NPFF2 receptor.
18565622 2008 Neuropeptide FF2 receptor distribution in the human brain. An immunohistochemical study.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17503329 2007 A common haplotype in the G-protein-coupled receptor gene GPR74 is associated with leanness and increased lipolysis.
17157836 2006 Alternative splicing of human and mouse NPFF2 receptor genes: Implications to receptor expression.