Property Summary

Ligand Count 16
NCBI Gene PubMed Count 23
PubMed Score 38.02
PubTator Score 31.31

Knowledge Summary

Patent (8,335)

TINX Plot

  Disease (3)

Disease Target Count P-value
interstitial cystitis 2312 6.2e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Pain agnosia 104 4.407 2.2
Mastitis 48 3.217 1.6
Hypotrichosis 1 15 3.12 1.6

Expression

  Differential Expression (1)

Disease log2 FC p
interstitial cystitis -1.100 6.2e-03

Gene RIF (14)

AA Sequence

MNSFFGTPAASWCLLESDVSSAPDKEAGRERRALSVQQRGGPAWSGSLEWSRQSAGDRRRLGLSRQTAKS      1 - 70
SWSRSRDRTCCCRRAWWILVPAADRARRERFIMNEKWDTNSSENWHPIWNVNDTKHHLYSDINITYVNYY     71 - 140
LHQPQVAAIFIISYFLIFFLCMMGNTVVCFIVMRNKHMHTVTNLFILNLAISDLLVGIFCMPITLLDNII    141 - 210
AGWPFGNTMCKISGLVQGISVAASVFTLVAIAVDRFQCVVYPFKPKLTIKTAFVIIMIIWVLAITIMSPS    211 - 280
AVMLHVQEEKYYRVRLNSQNKTSPVYWCREDWPNQEMRKIYTTVLFANIYLAPLSLIVIMYGRIGISLFR    281 - 350
AAVPHTGRKNQEQWHVVSRKKQKIIKMLLIVALLFILSWLPLWTLMMLSDYADLSPNELQIINIYIYPFA    351 - 420
HWLAFGNSSVNPIIYGFFNENFRRGFQEAFQLQLCQKRAKPMEAYALKAKSHVLINTSNQLVQESTFQNP    421 - 490
HGETLLYRKSAEKPQQELVMEELKETTNSSEI                                          491 - 522
//

Text Mined References (23)

PMID Year Title