Property Summary

NCBI Gene PubMed Count 49
PubMed Score 0.00
PubTator Score 122.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Enhanced S-cone syndrome 17 0.0 0.0
Retinitis Pigmentosa 37 1 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 5.8e-05
psoriasis 6694 1.4e-04
group 3 medulloblastoma 4104 2.8e-02
Disease Target Count
Retinitis Pigmentosa 226

Gene RIF (42)

AA Sequence

METRPTALMSSTVAAAAPAAGAASRKESPGRWGLGEDPTGVSPSLQCRVCGDSSSGKHYGIYACNGCSGF      1 - 70
FKRSVRRRLIYRCQVGAGMCPVDKAHRNQCQACRLKKCLQAGMNQDAVQNERQPRSTAQVHLDSMESNTE     71 - 140
SRPESLVAPPAPAGRSPRGPTPMSAARALGHHFMASLITAETCAKLEPEDADENIDVTSNDPEFPSSPYS    141 - 210
SSSPCGLDSIHETSARLLFMAVKWAKNLPVFSSLPFRDQVILLEEAWSELFLLGAIQWSLPLDSCPLLAP    211 - 280
PEASAAGGAQGRLTLASMETRVLQETISRFRALAVDPTEFACMKALVLFKPETRGLKDPEHVEALQDQSQ    281 - 350
VMLSQHSKAHHPSQPVRFGKLLLLLPSLRFITAERIELLFFRKTIGNTPMEKLLCDMFKN              351 - 410
//

Text Mined References (49)

PMID Year Title