Property Summary

NCBI Gene PubMed Count 24
Grant Count 11
Funding $643,927.72
PubMed Score 16.54
PubTator Score 12.34

Knowledge Summary

Patent

No data available

Expression

Gene RIF (7)

PMID Text
25825816 Sorting nexin 5 and dopamine d1 receptor regulate the expression of the insulin receptor in human renal proximal tubule cells
23195037 internalization of agonist-activated D1R is regulated by both SNX5 and GRK4, and that SNX5 is critical to the recycling of the receptor to the plasma membrane
22486813 Data indicate induction of caspase-2 by sorting nexin 5 (SNX5) in papillary thyroid carcinoma
19204726 Observational study of gene-disease association. (HuGE Navigator)
18596235 DOCK180 regulates CI-MPR trafficking via SNX5 and this function is independent of its guanine nucleotide exchange factor activity toward Rac1
17148574 SNX5 and SNX6 may constitute functional equivalents of Vps17p in mammalian retromer
15561769 SNX5 is localized to a subdomain of the early endosomes and is recruited to the cell membrane following EGF stimulation.

AA Sequence

MAAVPELLQQQEEDRSKLRSVSVDLNVDPSLQIDIPDALSERDKVKFTVHTKTTLPTFQSPEFSVTRQHE      1 - 70
DFVWLHDTLIETTDYAGLIIPPAPTKPDFDGPREKMQKLGEGEGSMTKEEFAKMKQELEAEYLAVFKKTV     71 - 140
SSHEVFLQRLSSHPVLSKDRNFHVFLEYDQDLSVRRKNTKEMFGGFFKSVVKSADEVLFTGVKEVDDFFE    141 - 210
QEKNFLINYYNRIKDSCVKADKMTRSHKNVADDYIHTAACLHSLALEEPTVIKKYLLKVAELFEKLRKVE    211 - 280
GRVSSDEDLKLTELLRYYMLNIEAAKDLLYRRTKALIDYENSNKALDKARLKSKDVKLAEAHQQECCQKF    281 - 350
EQLSESAKEELINFKRKRVAAFRKNLIEMSELEIKHARNNVSLLQSCIDLFKNN                    351 - 404
//

Text Mined References (40)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26220253 2015 Retromer: Structure, function, and roles in mammalian disease.
26172538 2015 Retromer Ensures the Degradation of Autophagic Cargo by Maintaining Lysosome Function in Drosophila.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25825816 2015 Sorting nexin 5 and dopamine d1 receptor regulate the expression of the insulin receptor in human renal proximal tubule cells.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25416956 2014 A proteome-scale map of the human interactome network.
24610942 2014 Isoform 5 of PIPKI? regulates the endosomal trafficking and degradation of E-cadherin.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
More...