Property Summary

NCBI Gene PubMed Count 13
Grant Count 4
Funding $298,312.42
PubMed Score 24.67
PubTator Score 12.02

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
tuberculosis -1.100 0.000
Breast cancer 1.100 0.002

Gene RIF (2)

PMID Text
24311514 SNX8: A candidate gene for 7p22 cardiac malformations including tetralogy of fallot.
21973056 SNX4, but not SNX1 and SNX8, is associated with the Rab11-recycling endosomes and that a high frequency of SNX4-mediated tubule formation is observed as endosomes undergo Rab4-to-Rab11 transition.

AA Sequence

MTGRAMDPLPAAAVGAAAEAEADEEADPPASDLPTPQAIEPQAIVQQVPAPSRMQMPQGNPLLLSHTLQE      1 - 70
LLARDTVQVELIPEKKGLFLKHVEYEVSSQRFKSSVYRRYNDFVVFQEMLLHKFPYRMVPALPPKRMLGA     71 - 140
DREFIEARRRALKRFVNLVARHPLFSEDVVLKLFLSFSGSDVQNKLKESAQCVGDEFLNCKLATRAKDFL    141 - 210
PADIQAQFAISRELIRNIYNSFHKLRDRAERIASRAIDNAADLLIFGKELSAIGSDTTPLPSWAALNSST    211 - 280
WGSLKQALKGLSVEFALLADKAAQQGKQEENDVVEKLNLFLDLLQSYKDLCERHEKGVLHKHQRALHKYS    281 - 350
LMKRQMMSATAQNREPESVEQLESRIVEQENAIQTMELRNYFSLYCLHQETQLIHVYLPLTSHILRAFVN    351 - 420
SQIQGHKEMSKVWNDLRPKLSCLFAGPHSTLTPPCSPPEDGLCPH                             421 - 465
//

Text Mined References (16)

PMID Year Title
24311514 2014 SNX8: A candidate gene for 7p22 cardiac malformations including tetralogy of fallot.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23085988 2012 Molecular basis for SNX-BAR-mediated assembly of distinct endosomal sorting tubules.
22688191 2012 Genome-wide association study in a Swedish population yields support for greater CNV and MHC involvement in schizophrenia compared with bipolar disorder.
21973056 2012 SNX-BAR-mediated endosome tubulation is co-ordinated with endosome maturation.
21269460 2011 Initial characterization of the human central proteome.
20889312 2010 A genome-wide meta-analysis identifies novel loci associated with schizophrenia and bipolar disorder.
19782049 2009 Sorting nexin 8 regulates endosome-to-Golgi transport.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
More...