Property Summary

NCBI Gene PubMed Count 13
PubMed Score 25.52
PubTator Score 12.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
tuberculosis 2010 1.5e-06
Breast cancer 3578 1.8e-03
Disease Target Count Z-score Confidence
Tetralogy of Fallot 67 4.457 2.2
hand, foot and mouth disease 13 3.177 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
Breast cancer 1.100 1.8e-03
tuberculosis -1.100 1.5e-06

Gene RIF (2)

AA Sequence

MTGRAMDPLPAAAVGAAAEAEADEEADPPASDLPTPQAIEPQAIVQQVPAPSRMQMPQGNPLLLSHTLQE      1 - 70
LLARDTVQVELIPEKKGLFLKHVEYEVSSQRFKSSVYRRYNDFVVFQEMLLHKFPYRMVPALPPKRMLGA     71 - 140
DREFIEARRRALKRFVNLVARHPLFSEDVVLKLFLSFSGSDVQNKLKESAQCVGDEFLNCKLATRAKDFL    141 - 210
PADIQAQFAISRELIRNIYNSFHKLRDRAERIASRAIDNAADLLIFGKELSAIGSDTTPLPSWAALNSST    211 - 280
WGSLKQALKGLSVEFALLADKAAQQGKQEENDVVEKLNLFLDLLQSYKDLCERHEKGVLHKHQRALHKYS    281 - 350
LMKRQMMSATAQNREPESVEQLESRIVEQENAIQTMELRNYFSLYCLHQETQLIHVYLPLTSHILRAFVN    351 - 420
SQIQGHKEMSKVWNDLRPKLSCLFAGPHSTLTPPCSPPEDGLCPH                             421 - 465
//

Text Mined References (16)

PMID Year Title