Property Summary

NCBI Gene PubMed Count 13
PubMed Score 24.67
PubTator Score 12.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
tuberculosis 1563 1.52486522917068E-6
Breast cancer 3099 0.00179360278721312
Disease Target Count Z-score Confidence
Tetralogy of Fallot 38 4.458 2.2
hand, foot and mouth disease 11 3.271 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
tuberculosis -1.100 0.000
Breast cancer 1.100 0.002

Synonym

Accession Q9Y5X2 A4D207 Q96I67
Symbols Mvp1

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
S.cerevisiae EggNOG Inparanoid

Gene RIF (2)

PMID Text
24311514 SNX8: A candidate gene for 7p22 cardiac malformations including tetralogy of fallot.
21973056 SNX4, but not SNX1 and SNX8, is associated with the Rab11-recycling endosomes and that a high frequency of SNX4-mediated tubule formation is observed as endosomes undergo Rab4-to-Rab11 transition.

AA Sequence

MTGRAMDPLPAAAVGAAAEAEADEEADPPASDLPTPQAIEPQAIVQQVPAPSRMQMPQGNPLLLSHTLQE      1 - 70
LLARDTVQVELIPEKKGLFLKHVEYEVSSQRFKSSVYRRYNDFVVFQEMLLHKFPYRMVPALPPKRMLGA     71 - 140
DREFIEARRRALKRFVNLVARHPLFSEDVVLKLFLSFSGSDVQNKLKESAQCVGDEFLNCKLATRAKDFL    141 - 210
PADIQAQFAISRELIRNIYNSFHKLRDRAERIASRAIDNAADLLIFGKELSAIGSDTTPLPSWAALNSST    211 - 280
WGSLKQALKGLSVEFALLADKAAQQGKQEENDVVEKLNLFLDLLQSYKDLCERHEKGVLHKHQRALHKYS    281 - 350
LMKRQMMSATAQNREPESVEQLESRIVEQENAIQTMELRNYFSLYCLHQETQLIHVYLPLTSHILRAFVN    351 - 420
SQIQGHKEMSKVWNDLRPKLSCLFAGPHSTLTPPCSPPEDGLCPH                             421 - 465
//

Text Mined References (16)

PMID Year Title
24311514 2014 SNX8: A candidate gene for 7p22 cardiac malformations including tetralogy of fallot.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23085988 2012 Molecular basis for SNX-BAR-mediated assembly of distinct endosomal sorting tubules.
22688191 2012 Genome-wide association study in a Swedish population yields support for greater CNV and MHC involvement in schizophrenia compared with bipolar disorder.
21973056 2012 SNX-BAR-mediated endosome tubulation is co-ordinated with endosome maturation.
21269460 2011 Initial characterization of the human central proteome.
20889312 2010 A genome-wide meta-analysis identifies novel loci associated with schizophrenia and bipolar disorder.
19782049 2009 Sorting nexin 8 regulates endosome-to-Golgi transport.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
More...