Property Summary

NCBI Gene PubMed Count 48
PubMed Score 102.83
PubTator Score 44.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Atopic dermatitis -1.300 1.4e-04
Breast cancer 2.600 4.7e-02
ductal carcinoma in situ -1.100 1.6e-03
intraductal papillary-mucinous adenoma (... 1.100 7.9e-04
mucosa-associated lymphoid tissue lympho... 1.247 2.2e-02
osteosarcoma -1.242 1.5e-02
ovarian cancer 2.000 4.0e-05
pancreatic cancer 2.000 1.2e-03
primary pancreatic ductal adenocarcinoma 2.417 2.4e-04
tuberculosis -2.500 4.1e-06

Protein-protein Interaction (12)

Gene RIF (25)

AA Sequence

MATKARVMYDFAAEPGNNELTVNEGEIITITNPDVGGGWLEGRNIKGERGLVPTDYVEILPSDGKDQFSC      1 - 70
GNSVADQAFLDSLSASTAQASSSAASNNHQVGSGNDPWSAWSASKSGNWESSEGWGAQPEGAGAQRNTNT     71 - 140
PNNWDTAFGHPQAYQGPATGDDDDWDEDWDGPKSSSYFKDSESADAGGAQRGNSRASSSSMKIPLNKFPG    141 - 210
FAKPGTEQYLLAKQLAKPKEKIPIIVGDYGPMWVYPTSTFDCVVADPRKGSKMYGLKSYIEYQLTPTNTN    211 - 280
RSVNHRYKHFDWLYERLLVKFGSAIPIPSLPDKQVTGRFEEEFIKMRMERLQAWMTRMCRHPVISESEVF    281 - 350
QQFLNFRDEKEWKTGKRKAERDELAGVMIFSTMEPEAPDLDLVEIEQKCEAVGKFTKAMDDGVKELLTVG    351 - 420
QEHWKRCTGPLPKEYQKIGKALQSLATVFSSSGYQGETDLNDAITEAGKTYEEIASLVAEQPKKDLHFLM    421 - 490
ECNHEYKGFLGCFPDIIGTHKGAIEKVKESDKLVATSKITLQDKQNMVKRVSIMSYALQAEMNHFHSNRI    491 - 560
YDYNSVIRLYLEQQVQFYETIAEKLRQALSRFPVM                                       561 - 595
//

Text Mined References (53)

PMID Year Title