Property Summary

NCBI Gene PubMed Count 44
Grant Count 18
R01 Count 5
Funding $1,706,132.63
PubMed Score 95.20
PubTator Score 44.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Gene RIF (24)

PMID Text
26608909 reduced levels of SNX9 were observed in blood samples from colorectal cancer patients, emphasizing the feasibility of its use as a diagnostic and prognostic biomarker sensing the host's immune status and inflammatory stage.
25256216 this study shows that SNX9 uses a unique mechanism to induce the tubulation of the plasma membrane which mediates proper membrane deformation during clathrin-mediated endocytosis.
23861900 SNX9 and CHC function in the same molecular pathway for chromosome alignment and segregation, which is dependent on their direct association.
22718350 The sorting nexin 9 (SNX9) subfamily members - SNX9, SNX18 and SNX33 - are required for progression and completion of mitosis.
20964629 study identifies critical amino acids within the BAR domains of SNX9 and SNX33 as determinants for the specificity of BAR domain-mediated interactions and suggests that SNX9 and SNX33 have distinct molecular functions.
20491914 The interaction with SNX9 is mediated by the proline-rich domain (PRD) of Itch, a domain distinct from the conventional WW recognition domain, and the SH3 domain of SNX9.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20129922 SNX9 binding to aldolase is structurally precluded by the binding of substrate to the active site.
20088948 Findings suggest that EspF promotes EPEC invasion of intestinal epithelial cells by harnessing the membrane-deforming activity of SNX9.
18940612 Tip-to-tip interactions between the BAR domains in a trigonal crystal form of Snx9(PX-BAR) reminiscent of functionally important interactions described for F-BAR domains.
More...

AA Sequence

MATKARVMYDFAAEPGNNELTVNEGEIITITNPDVGGGWLEGRNIKGERGLVPTDYVEILPSDGKDQFSC      1 - 70
GNSVADQAFLDSLSASTAQASSSAASNNHQVGSGNDPWSAWSASKSGNWESSEGWGAQPEGAGAQRNTNT     71 - 140
PNNWDTAFGHPQAYQGPATGDDDDWDEDWDGPKSSSYFKDSESADAGGAQRGNSRASSSSMKIPLNKFPG    141 - 210
FAKPGTEQYLLAKQLAKPKEKIPIIVGDYGPMWVYPTSTFDCVVADPRKGSKMYGLKSYIEYQLTPTNTN    211 - 280
RSVNHRYKHFDWLYERLLVKFGSAIPIPSLPDKQVTGRFEEEFIKMRMERLQAWMTRMCRHPVISESEVF    281 - 350
QQFLNFRDEKEWKTGKRKAERDELAGVMIFSTMEPEAPDLDLVEIEQKCEAVGKFTKAMDDGVKELLTVG    351 - 420
QEHWKRCTGPLPKEYQKIGKALQSLATVFSSSGYQGETDLNDAITEAGKTYEEIASLVAEQPKKDLHFLM    421 - 490
ECNHEYKGFLGCFPDIIGTHKGAIEKVKESDKLVATSKITLQDKQNMVKRVSIMSYALQAEMNHFHSNRI    491 - 560
YDYNSVIRLYLEQQVQFYETIAEKLRQALSRFPVM                                       561 - 595
//

Publication (49)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26608909 2016 Impaired SNX9 Expression in Immune Cells during Chronic Inflammation: Prognostic and Diagnostic Implications.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25256216 2014 The unique mechanism of SNX9 BAR domain for inducing membrane tubulation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23861900 2013 Sorting nexin 9 recruits clathrin heavy chain to the mitotic spindle for chromosome alignment and segregation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23085988 2012 Molecular basis for SNX-BAR-mediated assembly of distinct endosomal sorting tubules.
22718350 2012 SNX9, SNX18 and SNX33 are required for progression through and completion of mitosis.
21269460 2011 Initial characterization of the human central proteome.
More...