Property Summary

NCBI Gene PubMed Count 13
PubMed Score 5.24
PubTator Score 5.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.200 5.1e-05
Crohn's disease -1.000 8.4e-05
glioblastoma 1.100 7.6e-03
intraductal papillary-mucinous neoplasm ... 1.100 1.9e-02
lung cancer 1.100 2.5e-02
medulloblastoma, large-cell -1.800 1.1e-04
osteosarcoma 3.191 1.2e-05
ovarian cancer -2.500 9.6e-10
Pick disease -1.100 7.4e-05
progressive supranuclear palsy -1.300 6.7e-03
psoriasis -1.200 5.3e-04
ulcerative colitis -1.044 8.4e-04

Gene RIF (1)

AA Sequence

MLTEASLSIWGWGSLGIVLFLITFGPFVIFYLTFYILCFVGGGLVVTLLFGKTNSEKYLEQCEHSFLPPT      1 - 70
SPGVPKCLEEMKREARTIKIDRRLTGANIIDEPLQQVIQFSLRDYVQYWYYTLSDDESFLLEIRQTLQNA     71 - 140
LIQFATRSKEIDWQPYFTTRIVDDFGTHLRVFRKAQQKITEKDDQVKGTAEDLVDTFFEVEVEMEKEVCR    141 - 210
DLVCTSPKDEEGFLRDLCEVLLYLLLPPGDFQNKIMRYFVREILARGILLPLINQLSDPDYINQYVIWMI    211 - 280
RDSNCNYEAFMNIIKLSDNIGELEAVRDKAAEELQYLRSLDTAGDDINTIKNQINSLLFVKKVCDSRIQR    281 - 350
LQSGKEINTVKLAANFGKLCTVPLDSILVDNVALQFFMDYMQQTGGQAHLFFWMTVEGYRVTAQQQLEVL    351 - 420
LSRQRDGKHQTNQTKGLLRAAAVGIYEQYLSEKASPRVTVDDYLVAKLADTLNHEDPTPEIFDDIQRKVY    421 - 490
ELMLRDERFYPSFRQNALYVRMLAELDMLKDPSFRGSDDGDGESFNGSPTGSINLSLDDLSNVSSDDSVQ    491 - 560
LHAYISDTVYADYDPYAVAGVCNDHGKTYALYAITVHRRNLNSEEMWKTYRRYSDFHDFHMRITEQFESL    561 - 630
SSILKLPGKKTFNNMDRDFLEKRKKDLNAYLQLLLAPEMMKASPALAHYVYDFLENKAYSKGKGDFARKM    631 - 700
DTFVNPLRNSMRNVSNAVKSLPDSLAEGMTKMSDNMGKMSERLGQDIKQSFFKVPPLIPKTDSDPEHRRV    701 - 770
SAQLDDNVDDNIPLRVMLLLMDEVFDLKERNQWLRRNIKNLLQQLIRATYGDTINRKIVDHVDWMTSPEQ    771 - 840
VADSVKRFRDAFWPNGILAEAVPCRDKSIRMRTRVAGKTKLLAIMPDELKHIIGAETTRKGILRVFEMFQ    841 - 910
HNQLNRRMVYVFLEGFLETLFPQYKFRELFNKLHSRSKQMQKYKQKLQTTQAPSLQKR                911 - 968
//

Text Mined References (13)

PMID Year Title