Property Summary

NCBI Gene PubMed Count 96
Grant Count 35
R01 Count 29
Funding $2,808,729.39
PubMed Score 130.26
PubTator Score 136.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
astrocytic glioma -4.600 0.003
oligodendroglioma -3.800 0.041
psoriasis -4.400 0.000
cutaneous lupus erythematosus -3.200 0.001
glioblastoma -5.200 0.000
medulloblastoma -5.800 0.000
medulloblastoma, large-cell -4.000 0.014
primitive neuroectodermal tumor -4.600 0.000
Atopic dermatitis -4.000 0.000
non-small cell lung cancer -4.267 0.000
colon cancer -1.300 0.001
interstitial cystitis -5.000 0.000
lung adenocarcinoma -5.400 0.000
adult high grade glioma -5.000 0.000
pilocytic astrocytoma -2.200 0.019
posterior fossa group B ependymoma -2.500 0.008
subependymal giant cell astrocytoma -4.349 0.001
Breast cancer -5.200 0.000
lung carcinoma -5.700 0.000
breast carcinoma -3.500 0.000
invasive ductal carcinoma -1.300 0.036
pituitary cancer -1.900 0.013

Gene RIF (83)

PMID Text
26405993 WIF-1 down-regulation may promote tumor cells invasion and metastasis in salivary gland adenoid cystic carcinoma.
26352791 Results provide evidence that WIF1 is frequently methylated in oral squamous cell carcinoma (OSCC), but not in oral submucous fibrosis tissues, which results in reduced expression. This epigenetic biomarker can be used for the early detection of OSCC.
26342861 Data show that the WIF domain of Wnt Inhibitory Factor 1 (WIF1) is bound by C-terminal domains of Wnt proteins Wnt5a and Wnt7a at two sites.
25918249 WIF1 has a role in breast neoplasms: its inhibition significantly relieves the cancer stem cell-limiting effects of dietary compound isoliquiritigenin
25772239 Loss of WIF1 enhances the migratory potential of glioblastoma through WNT5A that activates the WNT/Ca(2+) pathway and MALAT1.
25681036 miR-603 regulates glioma development via Wnt-beta-cateninn signaling pathway and its WIF1 and CTNNBIP1 targets.
25487617 Further evaluation of the methylation of DACH1, DKK1, and WIF1 in a clinical patient group confirmed the frequent methylation of WIF1 and intermediate or low frequency of methylation of DACH1 or DKK1, respectively.
25142166 Altered expression of genes associated with telomere maintenance and cell function of human vascular endothelial cell at elevated temperature.
25107489 Aberrant methylation of APC gene was statistically significant associated with age over 50, DDK3 with male, SFRP4, WIF1, and WNT5a with increasing tumor stage SFRP4 and WIF1 with tumor differentiation and SFRP2 and SFRP5 with histological type
25025467 detection of methylated Wif-1 in either S or U has a higher performance accuracy compared to guaiac FOBT for advanced colorectal neoplasia screening
More...

AA Sequence

MARRSAFPAAALWLWSILLCLLALRAEAGPPQEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDF      1 - 70
RKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPC     71 - 140
LGKQDGVAAFEVDVIVMNSEGNTILQTPQNAIFFKTCQQAECPGGCRNGGFCNERRICECPDGFHGPHCE    141 - 210
KALCTPRCMNGGLCVTPGFCICPPGFYGVNCDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCEISKCPQ    211 - 280
PCRNGGKCIGKSKCKCSKGYQGDLCSKPVCEPGCGAHGTCHEPNKCQCQEGWHGRHCNKRYEASLIHALR    281 - 350
PAGAQLRQHTPSLKKAEERRDPPESNYIW                                             351 - 379
//

Publication (96)

PMID Year Title
26405993 2015 Aberrant Wnt-1/beta-catenin signaling and WIF-1 deficiency are important events which promote tumor cell invasion and metastasis in salivary gland adenoid cystic carcinoma.
26352791 2015 Expression and promoter methylation of Wnt inhibitory factor-1 in the development of oral submucous fibrosis.
26342861 2015 Wnts grasp the WIF domain of Wnt Inhibitory Factor 1 at two distinct binding sites.
25918249 2015 Dietary compound isoliquiritigenin prevents mammary carcinogenesis by inhibiting breast cancer stem cells through WIF1 demethylation.
25772239 2016 WIF1 re-expression in glioblastoma inhibits migration through attenuation of non-canonical WNT signaling by downregulating the lncRNA MALAT1.
25681036 2015 miR-603 promotes glioma cell growth via Wnt/?-catenin pathway by inhibiting WIF1 and CTNNBIP1.
25487617 2015 The negative regulators of Wnt pathway-DACH1, DKK1, and WIF1 are methylated in oral and oropharyngeal cancer and WIF1 methylation predicts shorter survival.
25416956 2014 A proteome-scale map of the human interactome network.
25142166 2014 Altered expression of genes associated with telomere maintenance and cell function of human vascular endothelial cell at elevated temperature.
25107489 2014 Promoter methylation analysis of WNT/?-catenin pathway regulators and its association with expression of DNMT1 enzyme in colorectal cancer.
More...