Property Summary

NCBI Gene PubMed Count 107
PubMed Score 143.19
PubTator Score 136.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adult high grade glioma -5.000 3.1e-05
astrocytic glioma -4.600 3.3e-03
Astrocytoma, Pilocytic -2.300 1.8e-02
Atopic dermatitis -4.000 1.2e-04
Breast cancer -5.200 7.8e-49
breast carcinoma -3.500 1.9e-22
colon cancer -1.300 6.3e-04
cutaneous lupus erythematosus -3.200 5.8e-04
glioblastoma -3.600 1.5e-05
group 3 medulloblastoma -5.100 4.3e-04
interstitial cystitis -4.900 6.2e-04
invasive ductal carcinoma -1.300 3.6e-02
lung adenocarcinoma -3.200 2.3e-10
lung carcinoma -5.700 2.6e-49
medulloblastoma, large-cell -4.000 1.4e-02
non-small cell lung cancer -4.267 9.6e-16
oligodendroglioma -3.800 4.1e-02
pituitary cancer -1.900 1.3e-02
posterior fossa group B ependymoma -2.500 7.9e-03
primitive neuroectodermal tumor -4.600 6.8e-05
psoriasis -4.400 3.4e-16
subependymal giant cell astrocytoma -4.349 9.6e-04

 MGI Phenotype (2)

Protein-protein Interaction (2)

Gene RIF (94)

AA Sequence

MARRSAFPAAALWLWSILLCLLALRAEAGPPQEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDF      1 - 70
RKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPC     71 - 140
LGKQDGVAAFEVDVIVMNSEGNTILQTPQNAIFFKTCQQAECPGGCRNGGFCNERRICECPDGFHGPHCE    141 - 210
KALCTPRCMNGGLCVTPGFCICPPGFYGVNCDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCEISKCPQ    211 - 280
PCRNGGKCIGKSKCKCSKGYQGDLCSKPVCEPGCGAHGTCHEPNKCQCQEGWHGRHCNKRYEASLIHALR    281 - 350
PAGAQLRQHTPSLKKAEERRDPPESNYIW                                             351 - 379
//

Text Mined References (107)

PMID Year Title