Property Summary

NCBI Gene PubMed Count 114
PubMed Score 216.18
PubTator Score 126.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adrenocortical carcinoma -1.129 2.5e-03
astrocytoma 1.100 8.9e-03
Barrett's esophagus 1.300 2.7e-02
breast carcinoma -1.200 6.9e-04
chronic rhinosinusitis -1.358 2.4e-02
fibroadenoma -1.700 1.0e-02
group 4 medulloblastoma -1.300 2.9e-04
intraductal papillary-mucinous adenoma (... 1.800 1.2e-02
invasive ductal carcinoma -1.100 2.6e-02
lung adenocarcinoma -2.600 4.8e-12
lung cancer -2.900 3.2e-06
medulloblastoma, large-cell -1.600 5.4e-05
non-small cell lung cancer -2.492 2.2e-24
ovarian cancer -3.400 7.5e-17
pancreatic cancer 1.300 3.4e-02
primary pancreatic ductal adenocarcinoma 1.465 1.4e-02
psoriasis -1.300 1.4e-06
ulcerative colitis 2.100 5.9e-07

 GO Component (1)

Gene RIF (106)

AA Sequence

MALSEPILPSFSTFASPCRERGLQERWPRAEPESGGTDDDLNSVLDFILSMGLDGLGAEAAPEPPPPPPP      1 - 70
PAFYYPEPGAPPPYSAPAGGLVSELLRPELDAPLGPALHGRFLLAPPGRLVKAEPPEADGGGGYGCAPGL     71 - 140
TRGPRGLKREGAPGPAASCMRGPGGRPPPPPDTPPLSPDGPARLPAPGPRASFPPPFGGPGFGAPGPGLH    141 - 210
YAPPAPPAFGLFDDAAAAAAALGLAPPAARGLLTPPASPLELLEAKPKRGRRSWPRKRTATHTCSYAGCG    211 - 280
KTYTKSSHLKAHLRTHTGEKPYHCNWDGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALH    281 - 350
MKRHM                                                                     351 - 355
//

Text Mined References (115)

PMID Year Title