Property Summary

NCBI Gene PubMed Count 102
Grant Count 176
R01 Count 89
Funding $29,750,376.59
PubMed Score 188.63
PubTator Score 126.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
Barrett's esophagus 1.300 0.027
astrocytoma 1.100 0.009
medulloblastoma, large-cell -1.600 0.000
adrenocortical carcinoma -1.129 0.003
primary pancreatic ductal adenocarcinoma 1.465 0.014
non-small cell lung cancer -2.492 0.000
intraductal papillary-mucinous adenoma (... 1.900 0.001
lung cancer -3.500 0.000
breast carcinoma -1.200 0.001
fibroadenoma -1.700 0.010
group 4 medulloblastoma -1.300 0.000
lung adenocarcinoma -2.600 0.000
psoriasis -1.900 0.000
invasive ductal carcinoma -1.100 0.026
ulcerative colitis 2.100 0.000
ovarian cancer -3.400 0.000
chronic rhinosinusitis -1.358 0.024
pancreatic cancer 1.300 0.034

Synonym

Accession Q9Y5W3 Q6IPC4 Q9UJS5 Q9UKR6
Symbols LKLF

Gene

 GO Component (1)

Gene RIF (94)

PMID Text
27027284 studies identify gain of MEKK3 signalling and KLF2/4 function as causal mechanisms for cerebral cavernous malformations pathogenesis that may be targeted to develop new CCM therapeutics
26853883 our data highlight an important role for KLF2/c-myc pathway in HCC development and progression.
26728187 These results indicate that the KDM3A-KLF2-IRF4 pathway plays an essential role in multiple myeloma cell survival and homing to the bone marrow, and therefore represents a therapeutic target.
26717516 These data provide support for a continuous role of KLF2 in stabilizing the vessel wall via co-temporal expression of eNOS and AQP1 both preceding and during the pathogenesis of atherosclerosis.
26456066 MicroRNA-30 mediates anti-inflammatory effects of shear stress and KLF2 via repression of Ang2.
26416422 Authors show that KLF2 induces the expression of CRABP2 and RARgamma and inhibits the expression FABP5 and PPARbeta/delta thereby shifting RA signaling from the pro-carcinogenic FABP5/PPARbeta/delta to the growth-suppressing CRABP2/RAR path.
26372274 Expression of KLF4 in mononuclear leukocytes positively correlates with cellular markers of immune activation, whereas KLF2 expression negatively correlates with markers of subclinical atherosclerosis in this HIV-infected population.
26336870 TUG1 overexpression was induced by nuclear transcription factor SP1 and TUG1 could epigeneticly repress Kruppel-like factor 2 (KLF2) transcription in HCC cells by binding with PRC2 and recruiting it to KLF2 promoter region.
26299712 In hyperuricemia, miR-92a downregulation increased KLF2 expression, subsequently inhibiting VEGFA, which resulted in decreased angiogenesis.
26212440 In conclusion, KLF2 suppressed the angiogenesis of LSECs through inhibition of cell proliferation, migration, and vessel tube formation.
More...

AA Sequence

MALSEPILPSFSTFASPCRERGLQERWPRAEPESGGTDDDLNSVLDFILSMGLDGLGAEAAPEPPPPPPP      1 - 70
PAFYYPEPGAPPPYSAPAGGLVSELLRPELDAPLGPALHGRFLLAPPGRLVKAEPPEADGGGGYGCAPGL     71 - 140
TRGPRGLKREGAPGPAASCMRGPGGRPPPPPDTPPLSPDGPARLPAPGPRASFPPPFGGPGFGAPGPGLH    141 - 210
YAPPAPPAFGLFDDAAAAAAALGLAPPAARGLLTPPASPLELLEAKPKRGRRSWPRKRTATHTCSYAGCG    211 - 280
KTYTKSSHLKAHLRTHTGEKPYHCNWDGCGWKFARSDELTRHYRKHTGHRPFQCHLCDRAFSRSDHLALH    281 - 350
MKRHM                                                                     351 - 355
//

Text Mined References (103)

PMID Year Title
27027284 2016 Cerebral cavernous malformations arise from endothelial gain of MEKK3-KLF2/4 signalling.
26853883 2016 Krüppel-like factor 2 promotes cell proliferation in hepatocellular carcinoma through up-regulation of c-myc.
26728187 2016 The KDM3A-KLF2-IRF4 axis maintains myeloma cell survival.
26717516 2015 Expression of Nitric Oxide-Transporting Aquaporin-1 Is Controlled by KLF2 and Marks Non-Activated Endothelium In Vivo.
26456066 2015 MicroRNA-30 mediates anti-inflammatory effects of shear stress and KLF2 via repression of angiopoietin 2.
26416422 2015 Kruppel-like factor 2 suppresses mammary carcinoma growth by regulating retinoic acid signaling.
26372274 2015 HIV vasculopathy: role of mononuclear cell-associated Krüppel-like factors 2 and 4.
26336870 2015 Long non-coding RNA TUG1 is up-regulated in hepatocellular carcinoma and promotes cell growth and apoptosis by epigenetically silencing of KLF2.
26299712 2015 High concentrations of uric acid inhibit angiogenesis via regulation of the Krüppel-like factor 2-vascular endothelial growth factor-A axis by miR-92a.
26212440 2015 Kruppel-like factor 2 inhibit the angiogenesis of cultured human liver sinusoidal endothelial cells through the ERK1/2 signaling pathway.
More...