Property Summary

NCBI Gene PubMed Count 48
PubMed Score 46.33
PubTator Score 36.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
acute quadriplegic myopathy 1.110 8.2e-06
astrocytoma 1.400 2.1e-02
Breast cancer 2.300 4.3e-02
diabetes mellitus -1.100 1.1e-02
Duchenne muscular dystrophy 1.116 3.1e-09
ductal carcinoma in situ 1.400 3.0e-04
lung carcinoma 1.200 3.9e-18
non-small cell lung cancer 1.237 3.7e-17
osteosarcoma 1.660 1.1e-04
ovarian cancer -1.400 3.8e-04
psoriasis 1.400 1.6e-04

Gene RIF (24)

AA Sequence

MAQKMDCGAGLLGFQAEASVEDSALLMQTLMEAIQISEAPPTNQATAAASPQSSQPPTANEMADIQVSAA      1 - 70
AARPKSAFKVQNATTKGPNGVYDFSQAHNAKDVPNTQPKAAFKSQNATPKGPNAAYDFSQAATTGELAAN     71 - 140
KSEMAFKAQNATTKVGPNATYNFSQSLNANDLANSRPKTPFKAWNDTTKAPTADTQTQNVNQAKMATSQA    141 - 210
DIETDPGISEPDGATAQTSADGSQAQNLESRTIIRGKRTRKINNLNVEENSSGDQRRAPLAAGTWRSAPV    211 - 280
PVTTQNPPGAPPNVLWQTPLAWQNPSGWQNQTARQTPPARQSPPARQTPPAWQNPVAWQNPVIWPNPVIW    281 - 350
QNPVIWPNPIVWPGPVVWPNPLAWQNPPGWQTPPGWQTPPGWQGPPDWQGPPDWPLPPDWPLPPDWPLPT    351 - 420
DWPLPPDWIPADWPIPPDWQNLRPSPNLRPSPNSRASQNPGAAQPRDVALLQERANKLVKYLMLKDYTKV    421 - 490
PIKRSEMLRDIIREYTDVYPEIIERACFVLEKKFGIQLKEIDKEEHLYILISTPESLAGILGTTKDTPKL    491 - 560
GLLLVILGVIFMNGNRASEAVLWEALRKMGLRPGVRHPLLGDLRKLLTYEFVKQKYLDYRRVPNSNPPEY    561 - 630
EFLWGLRSYHETSKMKVLRFIAEVQKRDPRDWTAQFMEAADEALDALDAAAAEAEARAEARTRMGIGDEA    631 - 700
VSGPWSWDDIEFELLTWDEEGDFGDPWSRIPFTFWARYHQNARSRFPQTFAGPIIGPGGTASANFAANFG    701 - 770
AIGFFWVE                                                                  771 - 778
//

Text Mined References (50)

PMID Year Title