Property Summary

NCBI Gene PubMed Count 40
Grant Count 20
R01 Count 10
Funding $1,064,986.34
PubMed Score 43.36
PubTator Score 36.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
psoriasis 1.400 0.000
osteosarcoma 1.660 0.000
astrocytoma 1.400 0.021
Duchenne muscular dystrophy 1.116 0.000
acute quadriplegic myopathy 1.110 0.000
non-small cell lung cancer 1.237 0.000
diabetes mellitus -1.100 0.011
Breast cancer 2.300 0.043
lung carcinoma 1.200 0.000
ductal carcinoma in situ 1.400 0.000
ovarian cancer 2.500 0.000

Gene RIF (18)

PMID Text
24710624 High NRAGE expression is associated with esophageal carcinomas.
23314527 MAGE-D1 plays important roles in the central nervous system in both developmental and adult stages.
22935435 Univariate and multivariate analyses indicated that MAGED1 expression was an independent prognostic factor in colorectal carcinoma
21109781 we establish the roles for Dlxin-1, one as an anti-tumorigenic and anti-invasive protein in high-grade gliomas and the other as an inducer of differentiation of glioma stem cells.
20868560 NRAGE may participate in the formation of radioresistance of TE13R120 cells by changing its subcellular localization, but its relationship with cell apoptosis has not been confirmed.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20100315 Data report that NRAGE, via the same XIAP-Tak1-Tab1 complex, is required for the phosphorylation of IKK -alpha/beta and subsequent transcriptional activation of the p65 subunit of NF-kappaB.
19639218 Enhanced expression of MAGE-D1 by gene transfer could reverse the malignant phenotypes of breast cancer cells.
17488777 Che-1 interacts with NRAGE and NRAGE overexpression downregulates endogenous Che-1 by targeting it for proteasome-dependent degradation.
17453828 These findings provide new insight into the ability of MAGE-D1 to suppress the motility and adhesion response of tumor cells by interfering with actin cytoskeleton reorganization and hypoxia inducible factor 1-dependent gene expression.
More...

AA Sequence

MAQKMDCGAGLLGFQAEASVEDSALLMQTLMEAIQISEAPPTNQATAAASPQSSQPPTANEMADIQVSAA      1 - 70
AARPKSAFKVQNATTKGPNGVYDFSQAHNAKDVPNTQPKAAFKSQNATPKGPNAAYDFSQAATTGELAAN     71 - 140
KSEMAFKAQNATTKVGPNATYNFSQSLNANDLANSRPKTPFKAWNDTTKAPTADTQTQNVNQAKMATSQA    141 - 210
DIETDPGISEPDGATAQTSADGSQAQNLESRTIIRGKRTRKINNLNVEENSSGDQRRAPLAAGTWRSAPV    211 - 280
PVTTQNPPGAPPNVLWQTPLAWQNPSGWQNQTARQTPPARQSPPARQTPPAWQNPVAWQNPVIWPNPVIW    281 - 350
QNPVIWPNPIVWPGPVVWPNPLAWQNPPGWQTPPGWQTPPGWQGPPDWQGPPDWPLPPDWPLPPDWPLPT    351 - 420
DWPLPPDWIPADWPIPPDWQNLRPSPNLRPSPNSRASQNPGAAQPRDVALLQERANKLVKYLMLKDYTKV    421 - 490
PIKRSEMLRDIIREYTDVYPEIIERACFVLEKKFGIQLKEIDKEEHLYILISTPESLAGILGTTKDTPKL    491 - 560
GLLLVILGVIFMNGNRASEAVLWEALRKMGLRPGVRHPLLGDLRKLLTYEFVKQKYLDYRRVPNSNPPEY    561 - 630
EFLWGLRSYHETSKMKVLRFIAEVQKRDPRDWTAQFMEAADEALDALDAAAAEAEARAEARTRMGIGDEA    631 - 700
VSGPWSWDDIEFELLTWDEEGDFGDPWSRIPFTFWARYHQNARSRFPQTFAGPIIGPGGTASANFAANFG    701 - 770
AIGFFWVE                                                                  771 - 778
//

Text Mined References (42)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24710624 2014 NRAGE promotes cell proliferation by stabilizing PCNA in a ubiquitin-proteasome pathway in esophageal carcinomas.
23314527 2013 The roles of MAGE-D1 in the neuronal functions and pathology of the central nervous system.
22935435 2012 Prognostic relevance of melanoma antigen D1 expression in colorectal carcinoma.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21109781 2011 Dlxin-1, a member of MAGE family, inhibits cell proliferation, invasion and tumorigenicity of glioma stem cells.
20868560 2010 Relationship between NRAGE and the radioresistance of esophageal carcinoma cell line TE13R120.
20864041 2010 MAGE-RING protein complexes comprise a family of E3 ubiquitin ligases.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20100315 2010 A role for NRAGE in NF-kappaB activation through the non-canonical BMP pathway.
More...