Property Summary

NCBI Gene PubMed Count 7
Grant Count 16
R01 Count 2
Funding $2,330,235.71
PubMed Score 6.42
PubTator Score 5.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
glioblastoma -1.500 0.001
atypical teratoid / rhabdoid tumor -1.700 0.000
medulloblastoma -1.200 0.000
medulloblastoma, large-cell -1.800 0.000
lung carcinoma 1.200 0.000
ovarian cancer -1.200 0.000
Breast cancer 1.100 0.001
pituitary cancer 1.100 0.001

Gene RIF (1)

PMID Text
21917931 functional interaction between ICln and HSPC038

AA Sequence

MARGQQKIQSQQKNAKKQAGQKKKQGHDQKAAAKAALIYTCTVCRTQMPDPKTFKQHFESKHPKTPLPPE      1 - 70
LADVQA                                                                     71 - 76
//

Publication (8)

PMID Year Title
21917931 2011 The molecular and functional interaction between ICln and HSPC038 proteins modulates the regulation of cell volume.
21269460 2011 Initial characterization of the human central proteome.
21107309 2011 Genome-wide pharmacogenomic study of neurocognition as an indicator of antipsychotic treatment response in schizophrenia.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.