Property Summary

NCBI Gene PubMed Count 7
PubMed Score 6.42
PubTator Score 5.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 3.91554410087691E-17
medulloblastoma 1524 4.65872056641911E-5
atypical teratoid / rhabdoid tumor 4369 8.51883794672415E-5
ovarian cancer 8492 2.32998764903976E-4
medulloblastoma, large-cell 6234 3.22344561104075E-4
glioblastoma 5572 6.70351765785546E-4
Breast cancer 3099 7.01383276620714E-4
pituitary cancer 1972 9.337871066749E-4
Disease Target Count Z-score Confidence
Schizophrenia 503 0.0 1.0

Expression

  Differential Expression (8)

Disease log2 FC p
glioblastoma -1.500 0.001
atypical teratoid / rhabdoid tumor -1.700 0.000
medulloblastoma -1.200 0.000
medulloblastoma, large-cell -1.800 0.000
lung carcinoma 1.200 0.000
ovarian cancer -1.200 0.000
Breast cancer 1.100 0.001
pituitary cancer 1.100 0.001

Synonym

Accession Q9Y5V0 A8K362
Symbols HSPC038
PNAS-106
PNAS-113

Gene

  Ortholog (9)

Species Source
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
21917931 functional interaction between ICln and HSPC038

AA Sequence

MARGQQKIQSQQKNAKKQAGQKKKQGHDQKAAAKAALIYTCTVCRTQMPDPKTFKQHFESKHPKTPLPPE      1 - 70
LADVQA                                                                     71 - 76
//

Text Mined References (8)

PMID Year Title
21917931 2011 The molecular and functional interaction between ICln and HSPC038 proteins modulates the regulation of cell volume.
21269460 2011 Initial characterization of the human central proteome.
21107309 2011 Genome-wide pharmacogenomic study of neurocognition as an indicator of antipsychotic treatment response in schizophrenia.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.