Property Summary

NCBI Gene PubMed Count 17
PubMed Score 292.33
PubTator Score 11.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer -1.300 3.2e-05
pancreatic ductal adenocarcinoma liver m... -1.655 3.3e-02

Gene RIF (6)

AA Sequence

MAFTLYSLLQAALLCVNAIAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLMNLIRSVRTVMRVPLIIV      1 - 70
NSIAIVLLLLFG                                                               71 - 82
//

Text Mined References (18)

PMID Year Title