Property Summary

NCBI Gene PubMed Count 16
Grant Count 35
R01 Count 17
Funding $11,962,434.92
PubMed Score 281.69
PubTator Score 11.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.655 0.033
ovarian cancer -1.300 0.000

Gene RIF (5)

PMID Text
22991235 We expand the phenotypic spectrum of MEDS caused by IER3IP1 gene mutations and propose that WRS and MEDS are overlapping clinical syndromes, displaying significant gene-dependent clinical variability.
19951536 Inhibiting the expression of IER3IP1 can inhibit erythroid differentiation and elevate the proliferation of K562 cells.
19885854 IER3IP1 gene expression is regulated by Sp1, Sp3, and the TNF-a; induction of the gene in HepG2 liver cancer cell line
18476594 Matrine can inhibit the growth of K562 cells, and transiently increase the expression level of IER3IP1 gene in a dose-dependent manner.
15276200 IER3IP1 gene was mapped to chromosome 18q12 and showed a high expression in heart, skeletal muscle and kidney, a moderate expression in liver and brain and a low expression in placenta, lung and peripheral blood leukocyte.

AA Sequence

MAFTLYSLLQAALLCVNAIAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLMNLIRSVRTVMRVPLIIV      1 - 70
NSIAIVLLLLFG                                                               71 - 82
//

Publication (17)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
22991235 2012 A homozygous IER3IP1 mutation causes microcephaly with simplified gyral pattern, epilepsy, and permanent neonatal diabetes syndrome (MEDS).
21835305 2011 Microcephaly with simplified gyration, epilepsy, and infantile diabetes linked to inappropriate apoptosis of neural progenitors.
19951536 2009 [Effect of IER3IP1 gene expression on the proliferation and erythroid differentiation of K562 cells].
19946888 2010 Defining the membrane proteome of NK cells.
19885854 2010 Transcriptional regulation of IER3IP1 gene by tumor necrosis factor-alpha and Sp family proteins.
18476594 2007 [The expression of IER3IP1 gene in K562 cells treated by matrine and its effect on the cell growth].
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...