Property Summary

NCBI Gene PubMed Count 11
PubMed Score 49.27
PubTator Score 35.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Substance-Related Disorders 114
Disease Target Count P-value
lung adenocarcinoma 2714 3.72076838114746E-8
malignant mesothelioma 3163 1.68164799635888E-6
ovarian cancer 8492 7.59667060079031E-5
medulloblastoma, large-cell 6234 1.04294631954057E-4
lung cancer 4473 2.16012909231901E-4
pancreatic cancer 2300 6.67600396491463E-4
group 4 medulloblastoma 1875 9.13103518468725E-4
Multiple myeloma 1328 0.0127896208215999
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0151271603523831
gastric carcinoma 832 0.0258185845096217
Disease Target Count Z-score Confidence
Kabuki syndrome 29 3.833 1.9
Myeloma 3 3.695 1.8

Expression

  Differential Expression (10)

Disease log2 FC p
Multiple myeloma 1.008 0.013
malignant mesothelioma 1.200 0.000
medulloblastoma, large-cell -1.600 0.000
pancreatic ductal adenocarcinoma liver m... -2.059 0.015
lung cancer -1.500 0.000
group 4 medulloblastoma -1.100 0.001
lung adenocarcinoma -1.100 0.000
gastric carcinoma -1.400 0.026
ovarian cancer -1.200 0.000
pancreatic cancer -1.200 0.001

Synonym

Accession Q9Y5U8 B2R5I7 Q5TI66 Q9HB67 Q9UQN4
Symbols MPYCD
BRP44L
CGI-129
dJ68L15.3

Gene

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA EggNOG

Gene RIF (6)

PMID Text
26642043 GTPBP3 plays a role in the regulation of MCP1 protein through AMPK signaling.
25458841 Tumor cells expressing MPC1 and MPC2 display increased mitochondrial pyruvate oxidation, with no changes in cell growth in adherent culture.
22628558 genetic studies of 3 families with children suffering from lactic acidosis and hyperpyruvatemia revealed a causal locus that mapped to MPC1 (BRP44L) changing single amino acids that are conserved throughout eukaryotes; data demonstrate that Mpc1 and Mpc2 form an essential part of the mitochondrial pyruvate carrier
20877624 Observational study of gene-disease association. (HuGE Navigator)
19834535 Observational study of gene-disease association. (HuGE Navigator)
17672918 the apparent occurrence of an unusual TG 3' splice site in intron 1 is discussed

AA Sequence

MAGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGRMTFALCCYSLTFMRFA      1 - 70
YKVQPRNWLLFACHATNEVAQLIQGGRLIKHEMTKTASA                                    71 - 109
//

Text Mined References (16)

PMID Year Title
26642043 2015 Defective Expression of the Mitochondrial-tRNA Modifying Enzyme GTPBP3 Triggers AMPK-Mediated Adaptive Responses Involving Complex I Assembly Factors, Uncoupling Protein 2, and the Mitochondrial Pyruvate Carrier.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25458841 2014 A role for the mitochondrial pyruvate carrier as a repressor of the Warburg effect and colon cancer cell growth.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22628558 2012 A mitochondrial pyruvate carrier required for pyruvate uptake in yeast, Drosophila, and humans.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19834535 2009 Sequential use of transcriptional profiling, expression quantitative trait mapping, and gene association implicates MMP20 in human kidney aging.
17672918 2007 Violating the splicing rules: TG dinucleotides function as alternative 3' splice sites in U2-dependent introns.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...