Property Summary

NCBI Gene PubMed Count 14
PubMed Score 56.37
PubTator Score 35.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
gastric carcinoma -1.400 2.6e-02
group 4 medulloblastoma -1.100 9.1e-04
lung adenocarcinoma -1.100 3.7e-08
lung cancer -1.500 2.2e-04
malignant mesothelioma 1.200 1.7e-06
medulloblastoma, large-cell -1.600 1.0e-04
Multiple myeloma 1.008 1.3e-02
ovarian cancer -1.200 7.6e-05
pancreatic cancer -1.200 6.7e-04
pancreatic ductal adenocarcinoma liver m... -2.059 1.5e-02

Protein-protein Interaction (2)

Gene RIF (9)

AA Sequence

MAGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGRMTFALCCYSLTFMRFA      1 - 70
YKVQPRNWLLFACHATNEVAQLIQGGRLIKHEMTKTASA                                    71 - 109
//

Text Mined References (19)

PMID Year Title