Property Summary

NCBI Gene PubMed Count 48
Grant Count 96
R01 Count 44
Funding $6,987,139.66
PubMed Score 215.59
PubTator Score 93.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
tuberculosis -1.400 0.000
non-small cell lung cancer 1.421 0.000
invasive ductal carcinoma 1.100 0.010

Synonym

Accession Q9Y5U5 B1AME1 O95851 Q5U0I4 Q9NYJ9
Symbols AITR
GITR
CD357
GITR-D

Gene

Gene RIF (36)

PMID Text
25973846 GITR expression can enhance the sensitivity to Bortezomib by inhibiting Bortezomib-induced NF-kappaB activation.
25961057 GITR is a crucial player in differentiation of thymic regulatory T cells and expansion of regulatory T cells, including both thymic regulatory T cells and peripheral regulatory T cells.
25445616 results suggest that the GITR rs3753348 polymorphism may be involved in the development and susceptibility of CWP.
25256257 Data may suggest a key role of regulatory GITR+CD25 low/-CD4+ T cells subset in the modulation of the abnormal immune response in lupus erythematosus (SLE) patients.
23935647 Our findings indicate the possible involvement of GITR-GITRL pathway in the pathogenesis of pSS.
23929911 these results show a higher susceptibility to apoptosis in patients' versus controls' T(reg) cells, suggesting that GITR is a T(reg)-cell marker that would be primarily involved in T(reg)-cell survival rather than in their suppressor function.
23785514 GITR acts as a potential tumor suppressor in MM.
23432692 Data indicate that the mRNAs of CTLA-4 and GITR genes were expressed at lower levels in CVID patients compared to control group.
22911397 Liver tumor Tregs up-regulate the expression of glucocorticoid-induced tumor necrosis factor receptor compared with Tregs in tumor-free liver tissue and blood.
22516990 GITR is pathologically expressed on Treg cells in systemic lupus erythematosus.
More...

AA Sequence

MAQHGAMGAFRALCGLALLCALSLGQRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGEECCSEW      1 - 70
DCMCVQPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDCASGTFSGGHEGHCKPWTDCTQFGFL     71 - 140
TVFPGNKTHNAVCVPGSPPAEPLGWLTVVLLAVAACVLLLTSAQLGLHIWQLRSQCMWPRETQLLLEVPP    141 - 210
STEDARSCQFPEEERGERSAEEKGRLGDLWV                                           211 - 241
//

Publication (50)

PMID Year Title
25973846 2015 Expression of GITR Enhances Multiple Myeloma Cell Sensitivity to Bortezomib.
25961057 2015 Glucocorticoid-induced tumour necrosis factor receptor-related protein: a key marker of functional regulatory T cells.
25445616 2014 GITR promoter polymorphism contributes to risk of coal workers' pneumoconiosis: a case-control study from China.
25256257 2014 Expansion of regulatory GITR+CD25 low/-CD4+ T cells in systemic lupus erythematosus patients.
23935647 2013 Correlation of increased blood levels of GITR and GITRL with disease severity in patients with primary Sjögren's syndrome.
23929911 2013 Low frequency of GITR+ T cells in ex vivo and in vitro expanded Treg cells from type 1 diabetic patients.
23892569 2013 Glucocorticoid-induced tumor necrosis factor receptor family-related ligand triggering upregulates vascular cell adhesion molecule-1 and intercellular adhesion molecule-1 and promotes leukocyte adhesion.
23785514 2013 Novel tumor suppressor function of glucocorticoid-induced TNF receptor GITR in multiple myeloma.
23432692 2013 Frequency and expression of inhibitory markers of CD4(+) CD25(+) FOXP3(+) regulatory T cells in patients with common variable immunodeficiency.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
More...