Property Summary

NCBI Gene PubMed Count 86
Grant Count 28
R01 Count 16
Funding $1,459,122.73
PubMed Score 84.04
PubTator Score 109.79

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis -1.100 0.000
medulloblastoma, large-cell -1.200 0.010
tuberculosis -1.100 0.001
ovarian cancer -1.500 0.000

Gene RIF (112)

PMID Text
26827442 Insulin resistance in obese boys leads to up-regulation of INSIG2 gene expression as well as to down-regulation of PFKFB1, PFKFB3, and HK2 genes in the blood cells as compared to obese patients with normal insulin sensitivity.
26662938 There may be a connection between INSIG2 expression and metastatic dissemination of colorectal cancer without any effect on tumorigenesis.
25607990 Results confirmed that genetic variation in INSIG2 is associated with both overweight and LDL in non-Hispanic white children.
25062423 The INSIG2 rs7566605 SNP may not play a role in the development of obesity-related metabolic traits in Malaysian Malays.
25028659 identified interaction of three genes in INSIG-SCAP-SREBP pathway on risk of obesity, revealing that these genes affect obesity more likely through a complex interaction pattern than single gene effect.
24518831 INSIG2 is involved in adipogenesis and MC4R effects hormonal appetite control in response to the amount of adipose tissue.
24458218 The results provided evidence for identifying genetic factors of nonalcoholic fatty liver disease (NAFLD) and may be useful for risk assessment and personalized medicine of NAFLD.
24371122 Data show the essential role of PPARgamma and PPARgamma coactivator 1alpha (PGC-1alpha) in up-regulating Insig-1/2 expression, defining a mechanistic pathway triggered by CD36, and leading to cholesterol depletion in hepatocytes.
23941145 This study suggests that the G allele in the INSIG2 single nucleotide polymorphism rs7566605 is more relevant for changes in intramuscular adipose tissue following training than for the amount of subcutaneous fat.
22968099 genetic association/nutrigenomics studies of populations in Samoa: Data suggest that an SNP in INSIG2 (rs9308762) is associated with increased risk of metabolic syndrome X in Samoans eating modern diet (rather than traditional Samoan diet).
More...

AA Sequence

MAEGETESPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQIQRNVTLFPPDVIASIFSSA      1 - 70
WWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINHASAKVDFDNNIQLSLTLAAL     71 - 140
SIGLWWTFDRSRSGFGLGVGIAFLATVVTQLLVYNGVYQYTSPDFLYVRSWLPCIFFAGGITMGNIGRQL    141 - 210
AMYECKVIAEKSHQE                                                           211 - 225
//

Text Mined References (89)

PMID Year Title
26827442 [EXPRESSION OF GENES, WHICH CONTROL GLUCOSE METABOLISM, IN BLOOD CELLS OF THE OBESE BOYS WITH INSULIN RESISTANCE].
26662938 2016 Insulin-induced gene 2 expression correlates with colorectal cancer metastasis and disease outcome.
25607990 2015 Association of INSIG2 polymorphism with overweight and LDL in children.
25416956 2014 A proteome-scale map of the human interactome network.
25062423 2014 Genetic associations of the INSIG2 rs7566605 polymorphism with obesity-related metabolic traits in Malaysian Malays.
25028659 2014 The gene-gene interaction of INSIG-SCAP-SREBP pathway on the risk of obesity in Chinese children.
24518831 2014 Controversial association results for INSIG2 on body mass index may be explained by interactions with age and with MC4R.
24458218 2014 Association of INSIG2 rs9308762 with ALT level independent of BMI.
24371122 2014 Scavenger receptor CD36 mediates inhibition of cholesterol synthesis via activation of the PPAR?/PGC-1? pathway and Insig1/2 expression in hepatocytes.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
More...