Property Summary

NCBI Gene PubMed Count 88
PubMed Score 88.71
PubTator Score 109.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Weight Gain 100 0.0 0.0
Disease Target Count P-value
psoriasis 6694 2.6e-06
ovarian cancer 8520 9.9e-05
tuberculosis 2010 1.4e-03
medulloblastoma, large-cell 6241 1.0e-02
Disease Target Count Z-score Confidence
Osteoporosis 363 0.0 3.0
Disease Target Count Z-score Confidence
Obesity 678 4.903 2.5

Expression

  Differential Expression (4)

Disease log2 FC p
medulloblastoma, large-cell -1.200 1.0e-02
ovarian cancer -1.500 9.9e-05
psoriasis -1.100 2.6e-06
tuberculosis -1.100 1.4e-03

Gene RIF (114)

AA Sequence

MAEGETESPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQIQRNVTLFPPDVIASIFSSA      1 - 70
WWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINHASAKVDFDNNIQLSLTLAAL     71 - 140
SIGLWWTFDRSRSGFGLGVGIAFLATVVTQLLVYNGVYQYTSPDFLYVRSWLPCIFFAGGITMGNIGRQL    141 - 210
AMYECKVIAEKSHQE                                                           211 - 225
//

Text Mined References (91)

PMID Year Title