Property Summary

NCBI Gene PubMed Count 20
PubMed Score 50.24
PubTator Score 19.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adrenocortical carcinoma -1.815 3.0e-06
adult high grade glioma -1.600 1.1e-05
atypical teratoid / rhabdoid tumor -2.100 1.3e-07
cystic fibrosis -1.200 1.3e-05
glioblastoma -1.500 2.1e-07
group 4 medulloblastoma -1.600 1.7e-06
interstitial cystitis 1.300 1.1e-03
intraductal papillary-mucinous neoplasm ... 1.600 1.5e-03
invasive ductal carcinoma -1.600 2.0e-03
lung cancer 2.000 3.6e-05
malignant mesothelioma 3.700 1.9e-09
medulloblastoma, large-cell -2.200 7.0e-06
non-small cell lung cancer -1.114 1.1e-09
oligodendroglioma -1.100 1.9e-02
ovarian cancer 1.500 2.6e-03
pituitary cancer 1.400 3.3e-05
primitive neuroectodermal tumor -2.400 2.3e-03
subependymal giant cell astrocytoma 1.847 5.2e-03

Gene RIF (11)

AA Sequence

MAARGVIAPVGESLRYAEYLQPSAKRPDADVDQQRLVRSLIAVGLGVAALAFAGRYAFRIWKPLEQVITE      1 - 70
TAKKISTPSFSSYYKGGFEQKMSRREAGLILGVSPSAGKAKIRTAHRRVMILNHPDKGGSPYVAAKINEA     71 - 140
KDLLETTTKH                                                                141 - 150
//

Text Mined References (24)

PMID Year Title