Property Summary

NCBI Gene PubMed Count 18
Grant Count 14
R01 Count 3
Funding $922,554.21
PubMed Score 45.10
PubTator Score 19.99

Knowledge Summary

Patent

No data available

Expression

Gene RIF (9)

PMID Text
26419808 These results identify the MCJ gene as a transcriptional target of IFNgamma and provide evidence of the dynamic adaptation of normal tissues to changes in the environment as a way to adapt metabolically to new conditions
26040030 Changes in the expression levels of IRS1, IRS2, RIPK2, RSPO1, and DNA JC15 genes might contribute to the development of insulin resistance and glucose intolerance in the obese boys.
24603329 Report functional connection between mitochondrial inner membrane protein translocation machinery-associated J-protein DnaJC15 and regulation of cell death pathways.
23263864 MCJ functions as J co-chaperone of the human TIM23 pre-protein translocase.
20877624 Observational study of gene-disease association. (HuGE Navigator)
18324624 Following transient expression of MDR-1 and MCJ, changes in the sensitivity of Sk-Ov-3 cells to paclitaxel were detected whereas expression of Src, Bcl-2 and Bcl-X(L) decreased the sensitivity of Sk-Ov-3 cells to carboplatin.
17283040 MCJ is required in these cells to prevent c-Jun-mediated expression of ABCB1 and maintain drug response.
16049974 evidence of MCJ hypermethylation in intracranial primitive neuroectodermal tumours (PNETs) (medulloblastomas, supratentorial PNETs & ependymomas); data indicate epigenetic inactivation of MCJ may play a role in development of pediatric brain tumours
14729589 loss of expression of MCJ by DNA methylation is associated with drug-resistance in ovarian cancer

AA Sequence

MAARGVIAPVGESLRYAEYLQPSAKRPDADVDQQRLVRSLIAVGLGVAALAFAGRYAFRIWKPLEQVITE      1 - 70
TAKKISTPSFSSYYKGGFEQKMSRREAGLILGVSPSAGKAKIRTAHRRVMILNHPDKGGSPYVAAKINEA     71 - 140
KDLLETTTKH                                                                141 - 150
//

Text Mined References (22)

PMID Year Title
26419808 2015 Ikaros mediates the DNA methylation-independent silencing of MCJ/DNAJC15 gene expression in macrophages.
26040030 2015 The expression of CCN2, IQSEC, RSPO1, DNAJC15, RIPK2, IL13RA2, IRS1, and IRS2 genes in blood of obese boys with insulin resistance.
25416956 2014 A proteome-scale map of the human interactome network.
24603329 2014 Chaperoning mitochondrial permeability transition: regulation of transition pore complex by a J-protein, DnaJC15.
23530063 2013 MCJ/DnaJC15, an endogenous mitochondrial repressor of the respiratory chain that controls metabolic alterations.
23263864 2013 Methylation-controlled J-protein MCJ acts in the import of proteins into human mitochondria.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19734545 2009 A genome-wide study of common SNPs and CNVs in cognitive performance in the CANTAB.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...