Property Summary

NCBI Gene PubMed Count 67
Grant Count 446
R01 Count 267
Funding $67,493,595.33
PubMed Score 1352.40
PubTator Score 149.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma 1.800 0.000
psoriasis -2.100 0.000
group 3 medulloblastoma 1.400 0.001
astrocytoma 1.300 0.019
glioblastoma 1.100 0.000
medulloblastoma, large-cell 1.500 0.000
primitive neuroectodermal tumor 1.200 0.000
acute quadriplegic myopathy 1.178 0.000
tuberculosis and treatment for 6 months -1.600 0.000
intraductal papillary-mucinous adenoma (... 1.100 0.009
lung cancer -1.500 0.011
Breast cancer 2.900 0.035
interstitial cystitis -1.100 0.001
ovarian cancer 1.100 0.002

Synonym

Accession Q9Y5S9 B3KQI9 Q6FHD1 Q6IQ40 Q9GZX8 Q9NZI4
Symbols TAR
Y14
RBM8
ZNRP
RBM8B
ZRNP1
BOV-1A
BOV-1B
BOV-1C
MDS014
DEL1q21.1
C1DELq21.1

Gene

PDB

1P27   2HYI   2J0Q   2J0S   2XB2   3EX7  

Protein-protein Interaction (165)

Gene RIF (19)

PMID Text
26887951 Y14 may selectively and differentially modulate protein biosynthesis.
26094033 this data suggests a novel role of RBM8a in the regulation of neurodevelopment.
25948253 It was demonstrated that Rbm8a is an essential neurogenesis regulator in embryonic cortical development.
25813282 Mutations of RBM8A and TBX6 are associated with disorders of the mullerian ducts.
23970407 Depletion of RNA-binding protein RBM8A (Y14) causes cell cycle deficiency and apoptosis in human tumor cells.
23817415 Y14 positively regulates signals for TNF-alpha-induced IL-6 production at multiple steps beyond an exon junction complex protein.
23115303 Data show that Y14 interacts directly with the decapping factor Dcp2 and the 5' cap structure of mRNAs via different but overlapping domains.
22944692 Positional proteomics analysis identifies the cleavage of human RNA binding motif protein 8A (RBM8A) at amino acid residues 56-57 by the HIV-1 protease
22366785 findings show that the two regulatory SNPs result in diminished RBM8A transcription in vitro and that Y14 expression is reduced in platelets from individuals with thrombocytopenia with absent radii (TAR)
22355610 Y14 mutants, which are deficient in binding to Magoh, could still be localized to the nucleus, suggesting the existence of both the nuclear import pathway and function for Y14 unaccompanied by Magoh
More...

AA Sequence

MADVLDLHEAGGEDFAMDEDGDESIHKLKEKAKKRKGRGFGSEEGSRARMREDYDSVEQDGDEPGPQRSV      1 - 70
EGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLM     71 - 140
GQPISVDWCFVRGPPKGKRRGGRRRSRSPDRRRR                                        141 - 174
//

Publication (83)

PMID Year Title
26887951 2016 A Point Mutation in the Exon Junction Complex Factor Y14 Disrupts Its Function in mRNA Cap Binding and Translation Enhancement.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26094033 2015 A critical role of RBM8a in proliferation and differentiation of embryonic neural progenitors.
25948253 2015 Rbm8a haploinsufficiency disrupts embryonic cortical development resulting in microcephaly.
25813282 2015 Variations in RBM8A and TBX6 are associated with disorders of the müllerian ducts.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24416299 2014 Slow co-evolution of the MAGO and Y14 protein families is required for the maintenance of their obligate heterodimerization mode.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23970407 2013 Depletion of RNA-binding protein RBM8A (Y14) causes cell cycle deficiency and apoptosis in human cells.
More...