Property Summary

Ligand Count 2
NCBI Gene PubMed Count 174
PubMed Score 397.64
PubTator Score 204.96

Knowledge Summary

Patent (14,743)

Expression

  Differential Expression (3)

Disease log2 FC p
colon cancer 1.800 3.5e-02
osteosarcoma 1.121 7.0e-06
psoriasis -1.200 3.5e-02

Protein-protein Interaction (3)

Gene RIF (171)

AA Sequence

MGNWVVNHWFSVLFLVVWLGLNVFLFVDAFLKYEKADKYYYTRKILGSTLACARASALCLNFNSTLILLP      1 - 70
VCRNLLSFLRGTCSFCSRTLRKQLDHNLTFHKLVAYMICLHTAIHIIAHLFNFDCYSRSRQATDGSLASI     71 - 140
LSSLSHDEKKGGSWLNPIQSRNTTVEYVTFTSIAGLTGVIMTIALILMVTSATEFIRRSYFEVFWYTHHL    141 - 210
FIFYILGLGIHGIGGIVRGQTEESMNESHPRKCAESFEMWDDRDSHCRRPKFEGHPPESWKWILAPVILY    211 - 280
ICERILRFYRSQQKVVITKVVMHPSKVLELQMNKRGFSMEVGQYIFVNCPSISLLEWHPFTLTSAPEEDF    281 - 350
FSIHIRAAGDWTENLIRAFEQQYSPIPRIEVDGPFGTASEDVFQYEVAVLVGAGIGVTPFASILKSIWYK    351 - 420
FQCADHNLKTKKIYFYWICRETGAFSWFNNLLTSLEQEMEELGKVGFLNYRLFLTGWDSNIVGHAALNFD    421 - 490
KATDIVTGLKQKTSFGRPMWDNEFSTIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFN    491 - 560
KENF                                                                      561 - 564
//

Text Mined References (176)

PMID Year Title