Property Summary

NCBI Gene PubMed Count 156
Grant Count 223
R01 Count 135
Funding $20,140,877.61
PubMed Score 361.55
PubTator Score 204.96

Knowledge Summary

Patent (14,743)

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis -1.200 0.035
osteosarcoma 1.121 0.000
colon cancer 1.800 0.035

Synonym

Accession Q9Y5S8 A8K836 O95691 Q2PP02 NOX-1
Symbols MOX1
NOH1
NOH-1
GP91-2

Gene

PANTHER Protein Class (2)

MLP Assay (20)

AID Type Active / Inconclusive / Inactive Description
1792 screening 130 / 0 / 15870 Luminescence-based primary cell-based high throughput screening assay to identify inhibitors of NADPH oxidase 1 (Nox1): Maybridge Library
1796 summary 2 / 0 / 0 Summary of probe development efforts to identify inhibitors of NADPH oxidase 1 (Nox1)
2154 screening 64 / 0 / 32 Late stage results from the probe development effort to identify inhibitors of Nox1.
2532 confirmatory 6 / 0 / 0 Late stage results from the probe development effort to identify inhibitors of NOX1: HEK/293 IC50
2538 confirmatory 16 / 0 / 6 Luminescence-based cell-based dose response assay to identify inhibitors of NADPH oxidase 1 (NOX1)
2541 screening 68 / 0 / 28 Luminescence-based cell-based assay to identify inhibitors of NADPH oxidase 1 (NOX1)
2545 screening 11 / 0 / 31 Late stage results from the probe development effort to identify inhibitors of (NADPH oxidase 1) NOX1: HEK/293 percent inhibition
2556 confirmatory 2 / 0 / 4 Late stage results from the probe development effort to identify inhibitors of (NADPH oxidase 1) NOX1: Xanthine Oxidase
2664 confirmatory 7 / 0 / 7 Late-stage luminescence-based cell-based dose response assay to identify inhibitors of NADPH oxidase 1 (NOX1): Synthesized analogs
2752 confirmatory 7 / 0 / 5 Late-stage luminescence-based cell-based dose response assay to identify inhibitors of NADPH oxidase 1 (NOX1): Synthesized analogs 2
More...

Gene RIF (155)

PMID Text
26658815 Urotensin II-increased reactive oxygen species production via the NADPH oxidase pathway is partially associated with activation of the PI3K/Akt and ERK cascades
26545779 Increased NOX1 expression in gallbladder cancer cells promoted the chemoresistance of the cells through elevating intracellular reactive oxygen species level and HIF1a expression as well as increasing MDR1 expression.
26339163 The results of this study demonstrate that OA itself is not a cause to increase arNOX activities.
26222337 NOX1 and NOX4 signaling mediates the pathogenesis of liver fibrosis, including the direct activation of HSC.
26116564 Molecular switch from NOX1 to NOX2 in colon cancer cells induces ROS production and subsequently enhances MMP-7 expression by deactivating AMPK.
26101350 These results indicate that physiological levels of ROS produced by the NOX complex modulate hippocampal neuronal polarity and axonal growth in vitro.
26065917 NADPH oxidase 1 was responsible for superoxide generation and cell proliferation in low-density lipoprotein-stimulated aortic smooth muscle cells.
25881670 Studies indicate the role of 70 kDa heat-shock protein (HSP70) in the activation of NADPH oxidase isoforms and in islet alpha- and beta-cell physiological function in health and Type 2 diabetes mellitus.
25722086 High glucose generated an increase in NADPH oxidase activity and expression in human vascular smooth muscle cells. Sequence analysis of human Nox1, Nox4, and Nox5 gene promoters was performed.
25592377 Enforced NOX1 expression promoted TLR4 signaling-enhanced NSCLC metastasis.
More...

AA Sequence

MGNWVVNHWFSVLFLVVWLGLNVFLFVDAFLKYEKADKYYYTRKILGSTLACARASALCLNFNSTLILLP      1 - 70
VCRNLLSFLRGTCSFCSRTLRKQLDHNLTFHKLVAYMICLHTAIHIIAHLFNFDCYSRSRQATDGSLASI     71 - 140
LSSLSHDEKKGGSWLNPIQSRNTTVEYVTFTSIAGLTGVIMTIALILMVTSATEFIRRSYFEVFWYTHHL    141 - 210
FIFYILGLGIHGIGGIVRGQTEESMNESHPRKCAESFEMWDDRDSHCRRPKFEGHPPESWKWILAPVILY    211 - 280
ICERILRFYRSQQKVVITKVVMHPSKVLELQMNKRGFSMEVGQYIFVNCPSISLLEWHPFTLTSAPEEDF    281 - 350
FSIHIRAAGDWTENLIRAFEQQYSPIPRIEVDGPFGTASEDVFQYEVAVLVGAGIGVTPFASILKSIWYK    351 - 420
FQCADHNLKTKKIYFYWICRETGAFSWFNNLLTSLEQEMEELGKVGFLNYRLFLTGWDSNIVGHAALNFD    421 - 490
KATDIVTGLKQKTSFGRPMWDNEFSTIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFN    491 - 560
KENF                                                                      561 - 564
//

Text Mined References (158)

PMID Year Title
26658815 2015 Urotensin-II-Mediated Reactive Oxygen Species Generation via NADPH Oxidase Pathway Contributes to Hepatic Oval Cell Proliferation.
26545779 2015 NOX1 mediates chemoresistance via HIF1?/MDR1 pathway in gallbladder cancer.
26339163 2015 Age-related NADPH Oxidase (arNOX) Activity Correlated with Cartilage Degradation and Bony Changes in Age-related Osteoarthritis.
26301257 2015 Defects in NADPH Oxidase Genes NOX1 and DUOX2 in Very Early Onset Inflammatory Bowel Disease.
26222337 2015 Deficiency of NOX1 or NOX4 Prevents Liver Inflammation and Fibrosis in Mice through Inhibition of Hepatic Stellate Cell Activation.
26116564 2015 NOX1 to NOX2 switch deactivates AMPK and induces invasive phenotype in colon cancer cells through overexpression of MMP-7.
26101350 2015 Contribution of NADPH oxidase to the establishment of hippocampal neuronal polarity in culture.
26065917 2015 NADPH oxidase activation contributes to native low-density lipoprotein-induced proliferation of human aortic smooth muscle cells.
25881670 2015 The regulatory roles of NADPH oxidase, intra- and extra-cellular HSP70 in pancreatic islet function, dysfunction and diabetes.
25722086 2015 High-glucose-increased expression and activation of NADPH oxidase in human vascular smooth muscle cells is mediated by 4-hydroxynonenal-activated PPAR? and PPAR?/?.
More...