Property Summary

NCBI Gene PubMed Count 45
Grant Count 38
R01 Count 15
Funding $3,286,985.73
PubMed Score 186.14
PubTator Score 83.28

Knowledge Summary

Patent (49,966)

Expression

  Differential Expression (13)

Disease log2 FC p
nephrosclerosis 1.012 0.000
gastric cancer -1.100 0.048
pancreatic cancer -1.200 0.038
malignant mesothelioma 1.300 0.000
osteosarcoma -1.001 0.019
cystic fibrosis 1.168 0.000
tuberculosis 1.300 0.000
non-small cell lung cancer -1.685 0.000
intraductal papillary-mucinous carcinoma... -1.400 0.000
pancreatic carcinoma -1.200 0.038
lung adenocarcinoma -1.500 0.000
inflammatory breast cancer 1.100 0.026
lung carcinoma -1.600 0.000

Gene RIF (34)

PMID Text
26416880 transient receptor potential vanilloid 2 is an intracellular Ca(2+)-permeable transient receptor potential vanilloid channel upregulated by nerve growth factor via the mitogen-activated protein kinase signaling pathway to augment neurite outgrowth.
25869297 This study evaluated the role of Trpv2 in arthritis and the pharmacological effects of Trpv2 agonists.
25641129 There appears to be TRPV1- or TRPV2-IR sympathetic pathway in the human stellate ganglion and spinal cord.
25333484 Using multiple sequence alignments as source for evolutionary, bioinformatics and statistical analysis, we have analyzed the evolutionary profiles for TRPV1, TRPV2, TRPV3 and TRPV4
25268680 Data indicate that transient receptor potential vanilloid 2 (TRPV2) siRNA virtually abolished stretch-activated current.
25001513 Aim of this review is to study the role of the TRPV2 channel, a member of the TRPV subfamily of TRP channels, in tumor progression. [review]
24878697 High expression of TRPV2 mRNA was closely associated with advanced pathological stage and worse survival of patients with esophageal squamous cell carcinoma.
24764033 TRPV1-, TRPV2-, P2X3-, and parvalbumin-immunoreactivity neurons in the human nodose ganglion innervate the pharynx and epiglottis through the pharyngeal branch and superior laryngeal nerve
24475260 An upregulation in the expression of vanilloid transient potential channels 2 enhances hypotonicity-induced cytosolic Ca(2) rise in human induced pluripotent stem cell model of Hutchinson-Gillford Progeria.
23964684 The addition of TRPV2 inhibitor Tranilast in the incubation medium prevent the calcium influx triggered by lysoPC and reduced lysoPC-induced cytotoxicity,whereas TRPV4 inhibitor RN 1734 was without effect
More...

AA Sequence

MTSPSSSPVFRLETLDGGQEDGSEADRGKLDFGSGLPPMESQFQGEDRKFAPQIRVNLNYRKGTGASQPD      1 - 70
PNRFDRDRLFNAVSRGVPEDLAGLPEYLSKTSKYLTDSEYTEGSTGKTCLMKAVLNLKDGVNACILPLLQ     71 - 140
IDRDSGNPQPLVNAQCTDDYYRGHSALHIAIEKRSLQCVKLLVENGANVHARACGRFFQKGQGTCFYFGE    141 - 210
LPLSLAACTKQWDVVSYLLENPHQPASLQATDSQGNTVLHALVMISDNSAENIALVTSMYDGLLQAGARL    211 - 280
CPTVQLEDIRNLQDLTPLKLAAKEGKIEIFRHILQREFSGLSHLSRKFTEWCYGPVRVSLYDLASVDSCE    281 - 350
ENSVLEIIAFHCKSPHRHRMVVLEPLNKLLQAKWDLLIPKFFLNFLCNLIYMFIFTAVAYHQPTLKKQAA    351 - 420
PHLKAEVGNSMLLTGHILILLGGIYLLVGQLWYFWRRHVFIWISFIDSYFEILFLFQALLTVVSQVLCFL    421 - 490
AIEWYLPLLVSALVLGWLNLLYYTRGFQHTGIYSVMIQKVILRDLLRFLLIYLVFLFGFAVALVSLSQEA    491 - 560
WRPEAPTGPNATESVQPMEGQEDEGNGAQYRGILEASLELFKFTIGMGELAFQEQLHFRGMVLLLLLAYV    561 - 630
LLTYILLLNMLIALMSETVNSVATDSWSIWKLQKAISVLEMENGYWWCRKKQRAGVMLTVGTKPDGSPDE    631 - 700
RWCFRVEEVNWASWEQTLPTLCEDPSGAGVPRTLENPVLASPPKEDEDGASEENYVPVQLLQSN          701 - 764
//

Publication (48)

PMID Year Title
26416880 2015 Nerve Growth Factor Regulates Transient Receptor Potential Vanilloid 2 via Extracellular Signal-Regulated Kinase Signaling To Enhance Neurite Outgrowth in Developing Neurons.
25869297 2015 The cation channel Trpv2 is a new suppressor of arthritis severity, joint damage, and synovial fibroblast invasion.
25641129 2015 Distribution of TRPV1 and TRPV2 in the human stellate ganglion and spinal cord.
25333484 2014 Dissecting domain-specific evolutionary pressure profiles of transient receptor potential vanilloid subfamily members 1 to 4.
25268680 2015 Mechanosensitive Ca²?-permeable channels in human leukemic cells: pharmacological and molecular evidence for TRPV2.
25001513 2014 Advances in transient receptor potential vanilloid-2 channel expression and function in tumor growth and progression.
24878697 2014 Overexpression of transient receptor potential vanilloid 2 is associated with poor prognosis in patients with esophageal squamous cell carcinoma.
24764033 2014 Distribution of TRPVs, P2X3, and parvalbumin in the human nodose ganglion.
24475260 2014 An upregulation in the expression of vanilloid transient potential channels 2 enhances hypotonicity-induced cytosolic Ca²? rise in human induced pluripotent stem cell model of Hutchinson-Gillford Progeria.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...