Property Summary

NCBI Gene PubMed Count 49
PubMed Score 197.87
PubTator Score 83.28

Knowledge Summary

Patent (49,966)

Expression

  Differential Expression (13)

Disease log2 FC p
cystic fibrosis 1.011 9.3e-05
gastric cancer -1.100 4.8e-02
inflammatory breast cancer 1.100 2.6e-02
intraductal papillary-mucinous carcinoma... -1.400 4.7e-04
lung adenocarcinoma -1.500 1.3e-08
lung carcinoma -1.600 1.2e-18
malignant mesothelioma 1.300 6.0e-05
nephrosclerosis 1.012 4.8e-05
non-small cell lung cancer -1.685 6.3e-18
osteosarcoma -1.001 1.9e-02
pancreatic cancer -1.200 3.8e-02
pancreatic carcinoma -1.200 3.8e-02
tuberculosis 1.300 2.1e-05

 CSPA Cell Line (1)

Gene RIF (38)

AA Sequence

MTSPSSSPVFRLETLDGGQEDGSEADRGKLDFGSGLPPMESQFQGEDRKFAPQIRVNLNYRKGTGASQPD      1 - 70
PNRFDRDRLFNAVSRGVPEDLAGLPEYLSKTSKYLTDSEYTEGSTGKTCLMKAVLNLKDGVNACILPLLQ     71 - 140
IDRDSGNPQPLVNAQCTDDYYRGHSALHIAIEKRSLQCVKLLVENGANVHARACGRFFQKGQGTCFYFGE    141 - 210
LPLSLAACTKQWDVVSYLLENPHQPASLQATDSQGNTVLHALVMISDNSAENIALVTSMYDGLLQAGARL    211 - 280
CPTVQLEDIRNLQDLTPLKLAAKEGKIEIFRHILQREFSGLSHLSRKFTEWCYGPVRVSLYDLASVDSCE    281 - 350
ENSVLEIIAFHCKSPHRHRMVVLEPLNKLLQAKWDLLIPKFFLNFLCNLIYMFIFTAVAYHQPTLKKQAA    351 - 420
PHLKAEVGNSMLLTGHILILLGGIYLLVGQLWYFWRRHVFIWISFIDSYFEILFLFQALLTVVSQVLCFL    421 - 490
AIEWYLPLLVSALVLGWLNLLYYTRGFQHTGIYSVMIQKVILRDLLRFLLIYLVFLFGFAVALVSLSQEA    491 - 560
WRPEAPTGPNATESVQPMEGQEDEGNGAQYRGILEASLELFKFTIGMGELAFQEQLHFRGMVLLLLLAYV    561 - 630
LLTYILLLNMLIALMSETVNSVATDSWSIWKLQKAISVLEMENGYWWCRKKQRAGVMLTVGTKPDGSPDE    631 - 700
RWCFRVEEVNWASWEQTLPTLCEDPSGAGVPRTLENPVLASPPKEDEDGASEENYVPVQLLQSN          701 - 764
//

Text Mined References (52)

PMID Year Title