Property Summary

NCBI Gene PubMed Count 8
Grant Count 14
R01 Count 11
Funding $1,966,292.32
PubMed Score 4.44
PubTator Score 39.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Rheumatoid Arthritis -2.700 0.004
osteosarcoma -1.578 0.005
atypical teratoid / rhabdoid tumor 1.700 0.000
glioblastoma 1.400 0.000
spina bifida 1.294 0.039

Gene RIF (3)

PMID Text
18187620 Knockdown of trafficking protein particle complex 1 (TRAPPC1) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
16828797 Mum2 binds to the alpha1-alpha2 loop of the Bet3-Tpc6B heterodimer.
11805826 This paper studies human as well as yeast TRAPP subunits.

AA Sequence

MTVHNLYLFDRNGVCLHYSEWHRKKQAGIPKEEEYKLMYGMLFSIRSFVSKMSPLDMKDGFLAFQTSRYK      1 - 70
LHYYETPTGIKVVMNTDLGVGPIRDVLHHIYSALYVELVVKNPLCPLGQTVQSELFRSRLDSYVRSLPFF     71 - 140
SARAG                                                                     141 - 145
//

Publication (9)

PMID Year Title
21269460 2011 Initial characterization of the human central proteome.
16828797 2006 Structure of the Bet3-Tpc6B core of TRAPP: two Tpc6 paralogs form trimeric complexes with Bet3 and Mum2.
16341674 2005 Transcriptome analysis of human gastric cancer.
15749823 2005 Multi-component protein complexes and Golgi membrane trafficking.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11805826 2002 Functional organization of the yeast proteome by systematic analysis of protein complexes.
10582700 1999 Two antigens recognized by autologous cytolytic T lymphocytes on a melanoma result from a single point mutation in an essential housekeeping gene.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.