Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.44
PubTator Score 39.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 5112 3.3e-08
glioblastoma 5792 1.7e-04
Rheumatoid arthritis 1191 3.8e-03
osteosarcoma 7950 4.6e-03
spina bifida 1074 3.9e-02
Disease Target Count Z-score Confidence
Cocaine abuse 19 4.674 2.3

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.700 3.3e-08
glioblastoma 1.400 1.7e-04
osteosarcoma -1.578 4.6e-03
Rheumatoid arthritis -2.700 3.8e-03
spina bifida 1.294 3.9e-02

Synonym

Accession Q9Y5R8 D3DTR0
Symbols BET5
MUM2

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (3)

AA Sequence

MTVHNLYLFDRNGVCLHYSEWHRKKQAGIPKEEEYKLMYGMLFSIRSFVSKMSPLDMKDGFLAFQTSRYK      1 - 70
LHYYETPTGIKVVMNTDLGVGPIRDVLHHIYSALYVELVVKNPLCPLGQTVQSELFRSRLDSYVRSLPFF     71 - 140
SARAG                                                                     141 - 145
//

Text Mined References (11)

PMID Year Title