Property Summary

NCBI Gene PubMed Count 34
PubMed Score 210.53
PubTator Score 160.55

Knowledge Summary

Patent

No data available

Expression

 GO Component (2)

Gene RIF (18)

AA Sequence

MPNDEAFSKPSTPSEAPHAPGVPPQGRAGGFGKASGALVGAASGSSAGGSSRGGGSGSGASDLGAGSKKS      1 - 70
PRLPKCARCRNHGYASPLKGHKRFCMWRDCQCKKCNLIAERQRVMAAQVALRRQQAQEEELGISHPIPLP     71 - 140
SAAELLVKRENNGSNPCLMTECSGTSQPPPASVPTTAASEGRMVIQDIPAVTSRGHVENTPDLVSDSTYY    141 - 210
SSFYQPSLFPYYNNLYNCPQYSMALAADSASGEVGNPLGGSPVKNSLRGLPGPYVPGQTGNQWQMKNMEN    211 - 280
RHAMSSQYRMHSYYPPPSYLGQSVPQFFTFEDAPSYPEARASVFSPPSSQDSGLVSLSSSSPISNKSTKA    281 - 350
VLECEPASEPSSFTVTPVIEEDE                                                   351 - 373
//

Text Mined References (37)

PMID Year Title