Property Summary

NCBI Gene PubMed Count 8
PubMed Score 20.65
PubTator Score 7.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Astrocytoma, Pilocytic 2.600 8.9e-04
ductal carcinoma in situ -2.700 1.7e-03
facioscapulohumeral dystrophy 2.700 8.6e-06
glioblastoma 1.600 3.7e-02
head and neck cancer and chronic obstruc... -1.200 6.8e-03
invasive ductal carcinoma -3.000 5.3e-03
non-small cell lung cancer 1.637 2.5e-05
psoriasis -1.700 4.4e-39

Gene RIF (1)

AA Sequence

MADPQAGSAAGDWEIDVESLELEEDVCGAPRSTPPGPSPPPADGDCEDDEDDDGVDEDAEEEGDGEEAGA      1 - 70
SPGMPGQPEQRGGPQPRPPLAPQASPAGTGPRERCTPAGGGAEPRKLSRTPKCARCRNHGVVSCLKGHKR     71 - 140
FCRWRDCQCANCLLVVERQRVMAAQVALRRQQATEDKKGLSGKQNNFERKAVYQRQVRAPSLLAKSILEG    141 - 210
YRPIPAETYVGGTFPLPPPVSDRMRKRRAFADKELENIMLEREYKEREMLETSQAAALFLPNRMVPGPDY    211 - 280
NSYKSAYSPSPVEPPSKDFCNFLPTCLDLTMQYSGSGNMELISSNVSVATTYRQYPLSSRFLVWPKCGPI    281 - 350
SDTLLYQQCLLNATTSVQALKPGASWDLKGARVQDGLSAEQDMMPSKLEGSLVLPHTPEIQTTRSDLQGH    351 - 420
QAVPERSAFSPPRRNFSPIVDTDSLAAQGHVLTKISKENTRHPLPLRHNPFHSLFQQTLTDKSGPELKTP    421 - 490
FVKEAFEETPKKHRECLVKDNQKYTFTIDRCAKDLFVAKQVGTKLSVNEPLSFSVESILKRPSSAITRVS    491 - 560
Q//

Text Mined References (10)

PMID Year Title