Property Summary

NCBI Gene PubMed Count 15
Grant Count 2
Funding $40,460
PubMed Score 24.02
PubTator Score 14.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Cryptorchidism 67 3.348 1.7

Expression

Synonym

Accession Q9Y5Q6 Q3MIY4 Q5VYD8 Insulin-like peptide 5
Symbols PRO182
UNQ156

Gene

 Grant Application (2)

PDB

2K1V   2KBC  

Gene RIF (7)

PMID Text
25043977 electrostatic interactions between INSL5 and RXFP4
25028498 Insl5 is an orexigenic hormone released from colonic L-cells, which promotes appetite during conditions of energy deprivation.
23438439 INSL5 may be a unique marker of colorectal enteroendocrine cells, and INSL5-RXFP4 signaling might play a role in an autocrine/paracrine fashion in the colorectal epithelium and rectal neuroendocrine tumors.
23128569 High INSL5 expression is associated with enteroendocrine cells of the neuroendocrine tumors.
20800603 Observational study of gene-disease association. (HuGE Navigator)
19178384 The hydrogen-bond network and electrostatic interactions between charged groups in INSL5 by NMR-monitored temperature and pH titrations was characterized.
15525639 Insulin-like peptide 5 is an endogenous ligand for GPCR142

AA Sequence

MKGSIFTLFLFSVLFAISEVRSKESVRLCGLEYIRTVIYICASSRWRRHQEGIPQAQQAETGNSFQLPHK      1 - 70
REFSEENPAQNLPKVDASGEDRLWGGQMPTEELWKSKKHSVMSRQDLQTLCCTDGCSMTDLSALC          71 - 135
//

Text Mined References (17)

PMID Year Title
25043977 2014 Identification of important residues of insulin-like peptide 5 and its receptor RXFP4 for ligand-receptor interactions.
25028498 2014 Insulin-like peptide 5 is an orexigenic gastrointestinal hormone.
23438439 2013 INSL5 may be a unique marker of colorectal endocrine cells and neuroendocrine tumors.
23128569 2013 INSL5 is a novel marker for human enteroendocrine cells of the large intestine and neuroendocrine tumours.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
19178384 2009 Structure of human insulin-like peptide 5 and characterization of conserved hydrogen bonds and electrostatic interactions within the relaxin framework.
18577758 2008 Dissociation of heterotrimeric g proteins in cells.
18576448 2008 Synthesis, conformation, and activity of human insulin-like peptide 5 (INSL5).
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15525639 2005 INSL5 is a high affinity specific agonist for GPCR142 (GPR100).
More...