Property Summary

NCBI Gene PubMed Count 50
PubMed Score 144.44
PubTator Score 129.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Atopic dermatitis -3.000 7.5e-04
Breast cancer 2.100 1.3e-02
cutaneous lupus erythematosus -1.600 3.0e-02
interstitial cystitis -2.600 9.5e-04
malignant mesothelioma -2.500 1.1e-07
non-small cell lung cancer and chronic o... -1.700 3.7e-02
pancreatic cancer 1.400 1.7e-03
pituitary cancer -1.600 2.5e-03

Gene RIF (47)

AA Sequence

MKQSPALAPEERCRRAGSPKPVLRADDNNMGNGCSQKLATANLLRFLLLVLIPCICALVLLLVILLSYVG      1 - 70
TLQKVYFKSNGSEPLVTDGEIQGSDVILTNTIYNQSTVVSTAHPDQHVPAWTTDASLPGDQSHRNTSACM     71 - 140
NITHSQCQMLPYHATLTPLLSVVRNMEMEKFLKFFTYLHRLSCYQHIMLFGCTLAFPECIIDGDDSHGLL    141 - 210
PCRSFCEAAKEGCESVLGMVNYSWPDFLRCSQFRNQTESSNVSRICFSPQQENGKQLLCGRGENFLCASG    211 - 280
ICIPGKLQCNGYNDCDDWSDEAHCNCSENLFHCHTGKCLNYSLVCDGYDDCGDLSDEQNCDCNPTTEHRC    281 - 350
GDGRCIAMEWVCDGDHDCVDKSDEVNCSCHSQGLVECRNGQCIPSTFQCDGDEDCKDGSDEENCSVIQTS    351 - 420
CQEGDQRCLYNPCLDSCGGSSLCDPNNSLNNCSQCEPITLELCMNLPYNSTSYPNYFGHRTQKEASISWE    421 - 490
SSLFPALVQTNCYKYLMFFSCTILVPKCDVNTGEHIPPCRALCEHSKERCESVLGIVGLQWPEDTDCSQF    491 - 560
PEENSDNQTCLMPDEYVEECSPSHFKCRSGQCVLASRRCDGQADCDDDSDEENCGCKERDLWECPSNKQC    561 - 630
LKHTVICDGFPDCPDYMDEKNCSFCQDDELECANHACVSRDLWCDGEADCSDSSDEWDCVTLSINVNSSS    631 - 700
FLMVHRAATEHHVCADGWQEILSQLACKQMGLGEPSVTKLIQEQEKEPRWLTLHSNWESLNGTTLHELLV    701 - 770
NGQSCESRSKISLLCTKQDCGRRPAARMNKRILGGRTSRPGRWPWQCSLQSEPSGHICGCVLIAKKWVLT    771 - 840
VAHCFEGRENAAVWKVVLGINNLDHPSVFMQTRFVKTIILHPRYSRAVVDYDISIVELSEDISETGYVRP    841 - 910
VCLPNPEQWLEPDTYCYITGWGHMGNKMPFKLQEGEVRIISLEHCQSYFDMKTITTRMICAGYESGTVDS    911 - 980
CMGDSGGPLVCEKPGGRWTLFGLTSWGSVCFSKVLGPGVYSNVSYFVEWIKRQIYIQTFLLN            981 - 1042
//

Text Mined References (53)

PMID Year Title