Property Summary

NCBI Gene PubMed Count 47
Grant Count 305
R01 Count 54
Funding $113,168,365.83
PubMed Score 129.63
PubTator Score 129.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma -2.500 0.000
cutaneous lupus erythematosus -1.600 0.030
Atopic dermatitis -3.000 0.001
pancreatic cancer 1.400 0.002
interstitial cystitis -2.600 0.001
Breast cancer 2.100 0.013
pituitary cancer -1.600 0.002
non-small cell lung cancer and chronic o... -1.700 0.037

Synonym

Accession Q9Y5Q5 B0ZBE3 Q2TBD2 Q4W5E5 Q4W5G6 Q9UHY2
Symbols CRN
ATC2
Lrp4
PEE5
TMPRSS10

Gene

Gene RIF (44)

PMID Text
26577631 serum levels of corin are significantly decreased in acute myocardial infarction patients
26488448 Data show that both furin and brain type natriuretic peptide (BNP) were more sensitive than corin in predicting cardiovascular complications in type 2 diabetes mellitus (T2DM) patients.
26344336 Serum soluble corin was significantly and positively associated with dyslipidemia
26259032 identified a PCSK6 mutation that impaired corin activation activity in a hypertensive patient
26086065 Increased serum soluble corin in mid pregnancy was associated with an increased risk for HDP(hypertensive disorders of pregnancy) .--increased serum soluble corin in mid pregnancy could be an indicator for HDP
26048191 corin may play an important role in the pathology of atrial fibrillation
26022632 Serum soluble corin was decreased in patients with stroke compared with healthy controls.
25981578 Circulating corin concentrations are related to infarct size in patients after ST-segment elevation myocardial infarction
25663063 Hypertensive participants had an increased serum corin level compared to those without hypertension, suggesting that corin may play a role in the pathology of hypertension.
25649697 Plasma corin levels decreased significantly from preoperative concentrations after coronary artery bypass graft surgery.
More...

AA Sequence

MKQSPALAPEERCRRAGSPKPVLRADDNNMGNGCSQKLATANLLRFLLLVLIPCICALVLLLVILLSYVG      1 - 70
TLQKVYFKSNGSEPLVTDGEIQGSDVILTNTIYNQSTVVSTAHPDQHVPAWTTDASLPGDQSHRNTSACM     71 - 140
NITHSQCQMLPYHATLTPLLSVVRNMEMEKFLKFFTYLHRLSCYQHIMLFGCTLAFPECIIDGDDSHGLL    141 - 210
PCRSFCEAAKEGCESVLGMVNYSWPDFLRCSQFRNQTESSNVSRICFSPQQENGKQLLCGRGENFLCASG    211 - 280
ICIPGKLQCNGYNDCDDWSDEAHCNCSENLFHCHTGKCLNYSLVCDGYDDCGDLSDEQNCDCNPTTEHRC    281 - 350
GDGRCIAMEWVCDGDHDCVDKSDEVNCSCHSQGLVECRNGQCIPSTFQCDGDEDCKDGSDEENCSVIQTS    351 - 420
CQEGDQRCLYNPCLDSCGGSSLCDPNNSLNNCSQCEPITLELCMNLPYNSTSYPNYFGHRTQKEASISWE    421 - 490
SSLFPALVQTNCYKYLMFFSCTILVPKCDVNTGEHIPPCRALCEHSKERCESVLGIVGLQWPEDTDCSQF    491 - 560
PEENSDNQTCLMPDEYVEECSPSHFKCRSGQCVLASRRCDGQADCDDDSDEENCGCKERDLWECPSNKQC    561 - 630
LKHTVICDGFPDCPDYMDEKNCSFCQDDELECANHACVSRDLWCDGEADCSDSSDEWDCVTLSINVNSSS    631 - 700
FLMVHRAATEHHVCADGWQEILSQLACKQMGLGEPSVTKLIQEQEKEPRWLTLHSNWESLNGTTLHELLV    701 - 770
NGQSCESRSKISLLCTKQDCGRRPAARMNKRILGGRTSRPGRWPWQCSLQSEPSGHICGCVLIAKKWVLT    771 - 840
VAHCFEGRENAAVWKVVLGINNLDHPSVFMQTRFVKTIILHPRYSRAVVDYDISIVELSEDISETGYVRP    841 - 910
VCLPNPEQWLEPDTYCYITGWGHMGNKMPFKLQEGEVRIISLEHCQSYFDMKTITTRMICAGYESGTVDS    911 - 980
CMGDSGGPLVCEKPGGRWTLFGLTSWGSVCFSKVLGPGVYSNVSYFVEWIKRQIYIQTFLLN            981 - 1042
//

Text Mined References (50)

PMID Year Title
26577631 2016 Association between serum corin levels and risk of acute myocardial infarction.
26488448 2015 Diagnostic utility of BNP, corin and furin as biomarkers for cardiovascular complications in type 2 diabetes mellitus patients.
26344336 2015 Increased serum soluble corin in dyslipidemia: A cross-sectional study.
26259032 2015 PCSK6-mediated corin activation is essential for normal blood pressure.
26086065 2015 Increased serum soluble corin in mid pregnancy is associated with hypertensive disorders of pregnancy.
26048191 2015 Increased plasma corin levels in patients with atrial fibrillation.
26022632 2015 Serum Soluble Corin is Decreased in Stroke.
25981578 2015 Circulating corin concentrations are related to infarct size in patients after ST-segment elevation myocardial infarction.
25663063 2015 Association Between High Serum Soluble Corin and Hypertension: A Cross-Sectional Study in a General Population of China.
25649697 2015 Plasma corin decreases after coronary artery bypass graft surgery and is associated with postoperative heart failure: a pilot study.
More...