Property Summary

NCBI Gene PubMed Count 58
PubMed Score 92.32
PubTator Score 74.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (7)

Disease Target Count P-value
lung carcinoma 2844 1.39973066100584E-14
chronic lymphosyte leukemia 232 2.4000990519901E-8
malignant mesothelioma 3163 5.84691417110375E-8
ulcerative colitis 2087 3.56079337976527E-7
lung cancer 4473 4.55454196122149E-6
osteosarcoma 7933 4.6903314504902E-5
glioblastoma 5572 5.69483755326948E-5
ovarian cancer 8492 4.9341613799486E-4
primary pancreatic ductal adenocarcinoma 1271 0.00106324150243485
Pick disease 1893 0.00116785363159653
cystic fibrosis 1670 0.00124850196365262
pancreatic cancer 2300 0.00125208290450073
medulloblastoma, large-cell 6234 0.00187114734435827
subependymal giant cell astrocytoma 2287 0.00418513106381084
atypical teratoid / rhabdoid tumor 4369 0.00493619209879977
fascioscapulohumeral muscular dystrophy 100 0.00705082503465324
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00777882953897804
primary Sjogren syndrome 789 0.00817187986564768
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0154270038186132
astrocytoma 1493 0.0228311816903331
esophageal adenocarcinoma 737 0.0244941346566387
gastric carcinoma 832 0.025573161874543
Breast cancer 3099 0.0279660283057879
group 4 medulloblastoma 1875 0.0329668268476037
mucosa-associated lymphoid tissue lymphoma 480 0.0375321667704527
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0455041297273467
Disease Target Count Z-score Confidence
Orofacial cleft 38 0.0 2.0
Disease Target Count Z-score Confidence
Cancer 2346 0.0 4.0

Expression

Synonym

Accession Q9Y5Q3 B3KNE1 Q9H1F1 Maf-B
Symbols KRML
MCTO
DURS3

Gene

PANTHER Protein Class (1)

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA Inparanoid
Anole lizard OMA EggNOG
Zebrafish OMA Inparanoid

Gene RIF (39)

PMID Text
26554594 MAFB represents a unique signature and likely important regulator of the primate islet beta-cell.
26204962 The rs2902940A allele carriers in the MAFB conferred a decreased serum ApoAI level in controls and an increased risk of coronary artery disease and ischemic stroke.
26115698 MAFB is a regulator and a marker of adipose tissue inflammation, a process that subsequently causes insulin resistance
26055874 MiR-223 negatively regulates the growth and migration of NPC cells via reducing MAFB expression, and this finding provides a novel insight into understanding miR-223 regulation mechanism in nasopharyngeal carcinoma tumorigenesis.
25917456 Gata3 interacted with Gcm2 and MafB, two known transcriptional regulators of parathyroid development, and synergistically stimulated the PTH promoter.
25721756 DNMT3A R882 mutation is associated with elevated expression of MAFB and M4/M5 immunophenotype of acute myeloid leukemia blasts.
24989131 These findings indicate that only a few transactivation domain-specific mutations within MAFB cause multicentric carpotarsal osteolysis.
24972815 rs6065259 was the most important single nucleotide polymorphism in MAFB (OR6065259-AA=0.45; 95% CI: 0.28 to 0.71; p=0.0027), followed by rs13041247; no association was found between rs11696257 and NSCLP.
24472656 data support the existence of a signaling cascade by which stimulation of macrophages with the IL-10 cytokine determines a sequential activation of STAT3 and MafB transcription factors
24327562 Mafb is responsible for executing one branch of the SGN differentiation program orchestrated by the Gata3 transcriptional network
More...

AA Sequence

MAAELSMGPELPTSPLAMEYVNDFDLLKFDVKKEPLGRAERPGRPCTRLQPAGSVSSTPLSTPCSSVPSS      1 - 70
PSFSPTEQKTHLEDLYWMASNYQQMNPEALNLTPEDAVEALIGSHPVPQPLQSFDSFRGAHHHHHHHHPH     71 - 140
PHHAYPGAGVAHDELGPHAHPHHHHHHQASPPPSSAASPAQQLPTSHPGPGPHATASATAAGGNGSVEDR    141 - 210
FSDDQLVSMSVRELNRHLRGFTKDEVIRLKQKRRTLKNRGYAQSCRYKRVQQKHHLENEKTQLIQQVEQL    211 - 280
KQEVSRLARERDAYKVKCEKLANSGFREAGSTSDSPSSPEFFL                               281 - 323
//

Text Mined References (61)

PMID Year Title
27181683 2016 Loss of MAFB Function in Humans and Mice Causes Duane Syndrome, Aberrant Extraocular Muscle Innervation, and Inner-Ear Defects.
26554594 2016 The MAFB transcription factor impacts islet ?-cell function in rodents and represents a unique signature of primate islet ?-cells.
26204962 2015 Association of polymorphisms in the MAFB gene and the risk of coronary artery disease and ischemic stroke: a case-control study.
26115698 2015 MAFB as a novel regulator of human adipose tissue inflammation.
26055874 2015 MiR-223 targeting MAFB suppresses proliferation and migration of nasopharyngeal carcinoma cells.
25917456 2015 Gata3 cooperates with Gcm2 and MafB to activate parathyroid hormone gene expression by interacting with SP1.
25721756 2015 DNMT3A R882 mutation is associated with elevated expression of MAFB and M4/M5 immunophenotype of acute myeloid leukemia blasts.
24989131 2014 Multicentric carpotarsal osteolysis syndrome is caused by only a few domain-specific mutations in MAFB, a negative regulator of RANKL-induced osteoclastogenesis.
24972815 2014 Association study of single nucleotide polymorphisms of MAFB with non-syndromic cleft lip with or without cleft palate in a population in Heilongjiang Province, northern China.
24472656 2014 MafB is a downstream target of the IL-10/STAT3 signaling pathway, involved in the regulation of macrophage de-activation.
More...