Property Summary

NCBI Gene PubMed Count 62
PubMed Score 101.19
PubTator Score 74.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Orofacial cleft 54 0.0 3.0
Disease Target Count Z-score Confidence
Cancer 2499 0.0 4.0

Expression

  Differential Expression (26)

 GWAS Trait (1)

Gene RIF (44)

AA Sequence

MAAELSMGPELPTSPLAMEYVNDFDLLKFDVKKEPLGRAERPGRPCTRLQPAGSVSSTPLSTPCSSVPSS      1 - 70
PSFSPTEQKTHLEDLYWMASNYQQMNPEALNLTPEDAVEALIGSHPVPQPLQSFDSFRGAHHHHHHHHPH     71 - 140
PHHAYPGAGVAHDELGPHAHPHHHHHHQASPPPSSAASPAQQLPTSHPGPGPHATASATAAGGNGSVEDR    141 - 210
FSDDQLVSMSVRELNRHLRGFTKDEVIRLKQKRRTLKNRGYAQSCRYKRVQQKHHLENEKTQLIQQVEQL    211 - 280
KQEVSRLARERDAYKVKCEKLANSGFREAGSTSDSPSSPEFFL                               281 - 323
//

Text Mined References (65)

PMID Year Title