Property Summary

NCBI Gene PubMed Count 47
PubMed Score 60.03
PubTator Score 99.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Goodpasture syndrome 6 4.963 2.5

Expression

  Differential Expression (16)

Disease log2 FC p
acute quadriplegic myopathy 1.194 2.1e-05
adrenocortical carcinoma 1.081 6.6e-04
adult high grade glioma -1.200 2.0e-04
atypical teratoid / rhabdoid tumor -1.300 1.6e-02
glioblastoma -1.400 3.5e-06
group 4 medulloblastoma -1.100 2.7e-04
invasive ductal carcinoma -1.100 2.1e-03
lung cancer -1.300 3.2e-04
medulloblastoma, large-cell -1.700 1.2e-05
osteosarcoma 1.444 2.0e-03
ovarian cancer -1.500 1.2e-06
posterior fossa group A ependymoma -1.100 4.4e-07
primary pancreatic ductal adenocarcinoma 1.137 2.6e-03
psoriasis 1.800 9.2e-05
Rheumatoid arthritis 1.700 1.7e-03
spina bifida -1.167 3.0e-02

Protein-protein Interaction (4)

Gene RIF (35)

AA Sequence

MSDNQSWNSSGSEEDPETESGPPVERCGVLSKWTNYIHGWQDRWVVLKNNALSYYKSEDETEYGCRGSIC      1 - 70
LSKAVITPHDFDECRFDISVNDSVWYLRAQDPDHRQQWIDAIEQHKTESGYGSESSLRRHGSMVSLVSGA     71 - 140
SGYSATSTSSFKKGHSLREKLAEMETFRDILCRQVDTLQKYFDACADAVSKDELQRDKVVEDDEDDFPTT    141 - 210
RSDGDFLHSTNGNKEKLFPHVTPKGINGIDFKGEAITFKATTAGILATLSHCIELMVKREDSWQKRLDKE    211 - 280
TEKKRRTEEAYKNAMTELKKKSHFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIEEQSQSEKVRLHWP    281 - 350
TSLPSGDAFSSVGTHRFVQKPYSRSSSMSSIDLVSASDDVHRFSSQVEEMVQNHMTYSLQDVGGDANWQL    351 - 420
VVEEGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRNDWETTIENFHVVETLADNAII    421 - 490
IYQTHKRVWPASQRDVLYLSVIRKIPALTENDPETWIVCNFSVDHDSAPLNNRCVRAKINVAMICQTLVS    491 - 560
PPEGNQEISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTAGKPILF          561 - 624
//

Text Mined References (56)

PMID Year Title