Property Summary

NCBI Gene PubMed Count 45
Grant Count 26
Funding $6,938,564.67
PubMed Score 59.22
PubTator Score 99.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Rheumatoid Arthritis 2.400 0.011
psoriasis 1.800 0.000
osteosarcoma -2.065 0.000
atypical teratoid / rhabdoid tumor -1.400 0.000
glioblastoma -1.400 0.000
medulloblastoma -1.300 0.000
medulloblastoma, large-cell -2.800 0.000
acute quadriplegic myopathy 1.194 0.000
adrenocortical carcinoma 1.081 0.001
primary pancreatic ductal adenocarcinoma 1.137 0.003
lung cancer -1.300 0.000
adult high grade glioma -1.200 0.000
posterior fossa group A ependymoma -1.100 0.000
spina bifida -1.167 0.030
invasive ductal carcinoma -1.400 0.001
ovarian cancer 2.300 0.000

Gene RIF (33)

PMID Text
24569996 phosphorylation of CERT at the FFAT motif-adjacent serine affects its affinity for VAP, which may regulate the inter-organelle trafficking of ceramide in response to the perturbation of cellular sphingomyelin and/or other sphingolipids
24395916 Both CERT isoforms, when immobilized, bind the globular head region of C1q and initiate the classical complement pathway. C1q binds endogenous CERTL on the surface of apoptotic cells.
22869376 Structural basis for the Golgi association by the pleckstrin homology domain of the ceramide trafficking protein (CERT)
22472120 Loss of the ceramide transfer protein augments EGF receptor signaling in breast cancer.
22396542 The START domain in GPBP is important for this interaction. SAP and GPBP form complexes in blood and partly colocalize in amyloid plaques from Alzheimer disease patients.
22226883 CERT is at a convergence point of non-vesicular and vesicular transport processes and plays a central role within the PKD signaling network at the Golgi complex. (Review)
22129459 during cellular stress, disassembly of Golgi structure together with inactivation of CERT by caspases causes a reduction in ceramide trafficking and sphingomyelin synthesis, and could contribute to the cellular response to pro-apoptotic stress
21909260 We hypothesize that sphingomyelin acquired by CERT-dependent transport of ceramide and subsequent conversion to SM is necessary for C. trachomatis replication whereas SM acquired by GBF1-dependent pathway is essential for inclusion growth and stability.
21832087 GPBP directs myofibril formation through interaction with intracellular downstream effector 130-kDa GPBP-interacting protein
21731489 the presence of IncD, CERT, VAPA/B, and potentially additional host and/or bacterial factors, at points of contact between the ER and the inclusion membrane provides a specialized microenvironment favorable to bacterial development.
More...

AA Sequence

MSDNQSWNSSGSEEDPETESGPPVERCGVLSKWTNYIHGWQDRWVVLKNNALSYYKSEDETEYGCRGSIC      1 - 70
LSKAVITPHDFDECRFDISVNDSVWYLRAQDPDHRQQWIDAIEQHKTESGYGSESSLRRHGSMVSLVSGA     71 - 140
SGYSATSTSSFKKGHSLREKLAEMETFRDILCRQVDTLQKYFDACADAVSKDELQRDKVVEDDEDDFPTT    141 - 210
RSDGDFLHSTNGNKEKLFPHVTPKGINGIDFKGEAITFKATTAGILATLSHCIELMVKREDSWQKRLDKE    211 - 280
TEKKRRTEEAYKNAMTELKKKSHFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIEEQSQSEKVRLHWP    281 - 350
TSLPSGDAFSSVGTHRFVQKPYSRSSSMSSIDLVSASDDVHRFSSQVEEMVQNHMTYSLQDVGGDANWQL    351 - 420
VVEEGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRNDWETTIENFHVVETLADNAII    421 - 490
IYQTHKRVWPASQRDVLYLSVIRKIPALTENDPETWIVCNFSVDHDSAPLNNRCVRAKINVAMICQTLVS    491 - 560
PPEGNQEISRDNILCKITYVANVNPGGWAPASVLRAVAKREYPKFLKRFTSYVQEKTAGKPILF          561 - 624
//

Publication (53)

PMID Year Title
25533962 2015 Large-scale discovery of novel genetic causes of developmental disorders.
25416956 2014 A proteome-scale map of the human interactome network.
24569996 2014 Phosphoregulation of the ceramide transport protein CERT at serine 315 in the interaction with VAMP-associated protein (VAP) for inter-organelle trafficking of ceramide in mammalian cells.
24395916 2014 Complement activation by ceramide transporter proteins.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23033978 2012 Diagnostic exome sequencing in persons with severe intellectual disability.
22869376 2012 Structural basis for the Golgi association by the pleckstrin homology domain of the ceramide trafficking protein (CERT).
22472120 2012 Loss of the ceramide transfer protein augments EGF receptor signaling in breast cancer.
22396542 2012 Goodpasture antigen-binding protein/ceramide transporter binds to human serum amyloid P-component and is present in brain amyloid plaques.
More...