Property Summary

NCBI Gene PubMed Count 11
PubMed Score 13.91
PubTator Score 9.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung cancer 2798 1.70966752368321E-27
lung adenocarcinoma 2714 4.87742126683782E-11
atypical teratoid/rhabdoid tumor 1095 1.88904616351037E-8
psoriasis 6685 2.08867770730369E-8
Breast cancer 3099 2.3575172784864E-7
lung cancer 4473 3.67032559679607E-7
adrenocortical carcinoma 1427 2.10114527937035E-4
pediatric high grade glioma 2712 7.03588783234054E-4
Atopic dermatitis 944 7.84861827872976E-4
glioblastoma 5572 0.00297482783662626
ulcerative colitis 2087 0.00487224718464958
ductal carcinoma in situ 1745 0.00766591338093909
colon cancer 1475 0.0102007787187017
medulloblastoma 1524 0.0141735549384766
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0149061131346503
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0152308519382635
invasive ductal carcinoma 2950 0.0222987471285248
active Crohn's disease 918 0.0277366520704607

Expression

  Differential Expression (18)

Disease log2 FC p
psoriasis -2.100 0.000
glioblastoma -1.500 0.003
atypical teratoid/rhabdoid tumor -2.100 0.000
medulloblastoma -1.400 0.014
Atopic dermatitis -1.400 0.001
adrenocortical carcinoma -2.000 0.000
non-small cell lung cancer -2.366 0.000
intraductal papillary-mucinous carcinoma... -1.600 0.015
intraductal papillary-mucinous neoplasm ... -1.400 0.015
lung cancer -4.200 0.000
colon cancer -2.300 0.010
active Crohn's disease 1.476 0.028
pediatric high grade glioma -1.200 0.001
lung adenocarcinoma -1.700 0.000
Breast cancer -2.300 0.000
ductal carcinoma in situ -1.400 0.008
invasive ductal carcinoma -1.900 0.022
ulcerative colitis 1.100 0.005

Synonym

Accession Q9Y5P3 B1B1K2 B4DQM9 E7EMN4 Q8N6X7
Symbols

Gene

  Ortholog (10)

 GO Process (1)

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
25716347 We specified the role of the RAI2 protein to function as a transcriptional regulator that controls the expression of several key regulators of breast epithelial integrity and cancer.

AA Sequence

MDDLQSQNLSMDMTDSPPALANNRLENGMAQLITTEAWNINSTDLVKKALVTVPAPSILNPPAESQSGMA      1 - 70
LKVAATVLQPLCLGESPVVMPIHMQVEGSSAPELNPNGNATYVMTTQGPVQLPVVLEQHVFQHLNSPLVL     71 - 140
PQEAPCSSSTIHNNLFQGAEDPEAQPQLLDLRIPSQPQEPTLPFEAVLQNLFPSQGTLGPPPCQPPPGYA    141 - 210
PVPPQPFSSPLSPLVPPATLLVPYPVIVPLPVPVPIPIPIPMPQSSESKFSSSFPKPPSSFGLHPFKGTQ    211 - 280
TPLEKDELKPFDILQPKEYFQLSRHTVIKMGSENEALDLSMKSVPWLKAGEVSPPIFQEDAALDLSVAAH    281 - 350
RKSEPPPETLYDSGASVDSSGHTVMEKLPSGMEISFAPATSHEAPAMMDSHISSSDAATEMLSQPNHPSG    351 - 420
EVKAENNIEMVGESQAAKVIVSVEDAVPTIFCGKIKGLSGVSTKNFSFKREDSVLQGYDINSQGEESMGN    421 - 490
AEPLRKPIKNRSIKLKKVNSQEIHMLPIKKQRLATFFPRK                                  491 - 530
//

Text Mined References (12)

PMID Year Title
25716347 2015 Suppression of early hematogenous dissemination of human breast cancer cells to bone marrow by retinoic Acid-induced 2.
25416956 2014 A proteome-scale map of the human interactome network.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15370543 2004 Refinement of the X-linked cataract locus (CXN) and gene analysis for CXN and Nance-Horan syndrome (NHS).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...