Property Summary

NCBI Gene PubMed Count 18
PubMed Score 0.00
PubTator Score 13.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Synonym

Accession Q9Y5P2 O75605 Q0VDC3 Q96IU8
Symbols CSAG3A
CT24.2

Gene

 GO Process (1)

 Compartment GO Term (0)

AA Sequence

MWMGLIQLVEGVKRKDQGFLEKEFYHKTNIKMRCEFLACWPAFTVLGEAWRDQVDWSRLLRDAGLVKMSR      1 - 70
KPRASSPLSNNHPPTPKRRGSGRHPLNPGPEALSKFPRQPGREKGPIKEVPGTKGSP                  71 - 127
//

Text Mined References (19)

PMID Year Title