Property Summary

NCBI Gene PubMed Count 18
PubMed Score 0.00
PubTator Score 13.96

Knowledge Summary

Patent

No data available

Synonym

Accession Q9Y5P2 O75605 Q0VDC3 Q96IU8
Symbols CSAG3A
CT24.2

Gene

 GO Process (1)

 Compartment GO Term (0)

AA Sequence

MWMGLIQLVEGVKRKDQGFLEKEFYHKTNIKMRCEFLACWPAFTVLGEAWRDQVDWSRLLRDAGLVKMSR      1 - 70
KPRASSPLSNNHPPTPKRRGSGRHPLNPGPEALSKFPRQPGREKGPIKEVPGTKGSP                  71 - 127
//

Publication (19)

PMID Year Title
20483736 2010 Human tumor antigen-specific helper and regulatory T cells share common epitope specificity but exhibit distinct T cell repertoire.
18395366 2008 Coordinated expression of clustered cancer/testis genes encoded in a large inverted repeat DNA structure.
17216190 2007 Taxol-resistance-associated gene-3 (TRAG-3/CSAG2) expression is predictive for clinical outcome in ovarian carcinoma patients.
16888034 2006 Spontaneous CD4+ T cell responses against TRAG-3 in patients with melanoma and breast cancers.
16685391 2006 Expression of the TRAG-3 gene in human esophageal cancer: the frequent synchronous expression of MAGE-3 gene.
15733385 2004 [In vitro induction of immune response by dendritic cells pulsed with TRAG-3-derived cytotoxic T lymphocyte epitope].
15580499 2005 Spontaneous T-cell responses against peptides derived from the Taxol resistance-associated gene-3 (TRAG-3) protein in cancer patients.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15120907 2004 Epigenetic regulation of the taxol resistance-associated gene TRAG-3 in human tumors.
12925976 2003 Expression of TRAG-3 in breast cancer.
More...