Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.65
PubTator Score 0.25

Knowledge Summary

Patent (324)

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Sickle Cell Anemia 53 3.753 1.9
Beta thalassemia 16 3.219 1.6

AA Sequence

MWPNITAAPFLLTGFPGLEAAHHWISIPFFAVYVCILLGNGMLLYLIKHDHSLHEPMYYFLTMLAGTDLM      1 - 70
VTLTTMPTVMGILWVNHREISSVGCFLQAYFIHSLSVVESGSLLAMAYDCFIAIRNPLRYASILTNTRVI     71 - 140
ALGVGVFLRGFVSILPVILRLFSFSYCKSHVITRAFCLHQEIMRLACADITFNRLYPVILISLTIFLDCL    141 - 210
IILFSYILILNTVIGIASGEERAKALNTCISHISCVLIFYVTVMGLTFIYRFGKNVPEVVHIIMSYIYFL    211 - 280
FPPLMNPVIYSIKTKQIQYGIIRLLSKHRFSS                                          281 - 312
//

Text Mined References (7)

PMID Year Title