Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.65
PubTator Score 0.25

Knowledge Summary

Patent (324)

TINX Plot

  Disease Relevance (2)

AA Sequence

MWPNITAAPFLLTGFPGLEAAHHWISIPFFAVYVCILLGNGMLLYLIKHDHSLHEPMYYFLTMLAGTDLM      1 - 70
VTLTTMPTVMGILWVNHREISSVGCFLQAYFIHSLSVVESGSLLAMAYDCFIAIRNPLRYASILTNTRVI     71 - 140
ALGVGVFLRGFVSILPVILRLFSFSYCKSHVITRAFCLHQEIMRLACADITFNRLYPVILISLTIFLDCL    141 - 210
IILFSYILILNTVIGIASGEERAKALNTCISHISCVLIFYVTVMGLTFIYRFGKNVPEVVHIIMSYIYFL    211 - 280
FPPLMNPVIYSIKTKQIQYGIIRLLSKHRFSS                                          281 - 312
//

Text Mined References (7)

PMID Year Title
22908908 2012 Personal receptor repertoires: olfaction as a model.
16939646 2006 A probabilistic classifier for olfactory receptor pseudogenes.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12213199 2002 DEFOG: a practical scheme for deciphering families of genes.
11121057 2000 Comparative structural and functional analysis of the olfactory receptor genes flanking the human and mouse beta-globin gene clusters.
10220430 1999 Conservation of sequence and structure flanking the mouse and human beta-globin loci: the beta-globin genes are embedded within an array of odorant receptor genes.