Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.56
PubTator Score 0.55

Knowledge Summary

Patent (260)

Expression

  Differential Expression (4)

Disease log2 FC p
medulloblastoma, large-cell 1.300 0.000
diabetes mellitus 1.300 0.001
ovarian cancer 1.100 0.000
psoriasis -1.100 0.048

AA Sequence

MWYNNSAGPFLLTGFLGSEAVHYRISMSFFVIYFSVLFGNGTLLVLIWNDHSLHEPMYYFLAMLADTDLG      1 - 70
MTFTTMPTVLGVLLLDQREIAHAACFTQSFIHSLAIVESGILLVLAYDCFIAIRTPLRYNCILTNSRVMN     71 - 140
IGLGVLMRGFMSILPIILSLYCYPYCGSRALLHTFCLHQDVIKLACADITFNHIYPIIQTSLTVFLDALI    141 - 210
IIFSYILILKTVMGIASGQEEAKSLNTCVSHISCVLVFHITVMGLSFIHRFGKHAPHVVPITMSYVHFLF    211 - 280
PPFVNPIIYSIKTKQIQRSIIRLFSGQSRA                                            281 - 310
//

Text Mined References (5)

PMID Year Title
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11121057 2000 Comparative structural and functional analysis of the olfactory receptor genes flanking the human and mouse beta-globin gene clusters.
10220430 1999 Conservation of sequence and structure flanking the mouse and human beta-globin loci: the beta-globin genes are embedded within an array of odorant receptor genes.