Property Summary

NCBI Gene PubMed Count 34
PubMed Score 26.10
PubTator Score 16.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
psoriasis 6685 2.52701418014885E-78
non-small cell lung cancer 2798 1.67416629607941E-19
adrenocortical carcinoma 1427 1.31486522574021E-6
malignant mesothelioma 3163 2.09143634638091E-6
colon cancer 1475 1.01709315270091E-5
intraductal papillary-mucinous neoplasm (IPMN) 3289 1.85859626997636E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 2.11392612544404E-4
lung cancer 4473 5.9826902043181E-4
lung adenocarcinoma 2714 0.00143189459968801
invasive ductal carcinoma 2950 0.00193783456158295
ductal carcinoma in situ 1745 0.00410416961161661
group 3 medulloblastoma 2254 0.00659387712216579
Breast cancer 3099 0.0405034477806529
Disease Target Count Z-score Confidence
Meier-Gorlin syndrome 12 7.311 3.7
Disease Target Count Z-score Confidence
Seckel syndrome 35 4.391 2.2
Microcephaly 149 3.443 1.7
Pulmonary emphysema 34 3.189 1.6
Disease Target Count
Meier-Gorlin syndrome 3 1

Expression

  Differential Expression (13)

Synonym

Accession Q9Y5N6 B3KN89
Symbols ORC6L

Gene

PDB

3M03  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Fruitfly OMA Inparanoid

Gene RIF (10)

PMID Text
25691413 The present report expands the clinical phenotype associated with ORC6 mutations to include severely abnormal embryological development suggesting a possible genotype-phenotype correlation.
24137536 our results suggest that Meier-Gorlin syndrome mutations in Orc6 impair the formation of ORC hexamers, interfering with appropriate ORC functions
21502537 Structural analysis of human Orc6 protein reveals a homology with transcription factor TFIIB.
21461783 findings show that Orc6 not only interacts with Orc1-Orc5 but also with the initiation factor Cdc6, and that Orc6 functions at different stages of the replication initiation process.
19541634 In a cross-species complementation experiment, the expression of human Orc6 in Drosophila Orc6 mutant cells rescued DNA replication, suggesting that this function of the protein is conserved among metazoans.
19112505 Orc6 has a role in sensitizing human colon cancer cells to 5-fluorouracil and cisplatin
15910003 Study using HCT116 haplo-insufficient cells and Orc2 hypomorphic cells demonstrates that the binding of human Ku to replication origins precedes that of Orc-3, -4, and -6 subunit binding.
12169736 results implicate Orc6 as an essential gene that coordinates chromosome replication and segregation with cytokinesis
11593009 Functional studies of the Drosophila homolog
8266075 Functional studies of the yeast homolog

AA Sequence

MGSELIGRLAPRLGLAEPDMLRKAEEYLRLSRVKCVGLSARTTETSSAVMCLDLAASWMKCPLDRAYLIK      1 - 70
LSGLNKETYQSCLKSFECLLGLNSNIGIRDLAVQFSCIEAVNMASKILKSYESSLPQTQQVDLDLSRPLF     71 - 140
TSAALLSACKILKLKVDKNKMVATSGVKKAIFDRLCKQLEKIGQQVDREPGDVATPPRKRKKIVVEAPAK    141 - 210
EMEKVEEMPHKPQKDEDLTQDYEEWKRKILENAASAQKATAE                                211 - 252
//

Text Mined References (39)

PMID Year Title
25691413 2015 Further insight into the phenotype associated with a mutation in the ORC6 gene, causing Meier-Gorlin syndrome 3.
25416956 2014 A proteome-scale map of the human interactome network.
24137536 2013 A Meier-Gorlin syndrome mutation in a conserved C-terminal helix of Orc6 impedes origin recognition complex formation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22427655 2012 Leucine-rich repeat and WD repeat-containing protein 1 is recruited to pericentric heterochromatin by trimethylated lysine 9 of histone H3 and maintains heterochromatin silencing.
21502537 2011 Structural analysis of human Orc6 protein reveals a homology with transcription factor TFIIB.
21461783 2011 Different roles of the human Orc6 protein in the replication initiation process.
21358632 2011 Mutations in the pre-replication complex cause Meier-Gorlin syndrome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
More...