Property Summary

NCBI Gene PubMed Count 9
PubMed Score 17.06
PubTator Score 7.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 3.6e-06
lung cancer 4740 5.8e-04

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer 1.700 5.8e-04
osteosarcoma -1.232 3.6e-06

Synonym

Accession Q9Y5N5 B2RA97 Q96F73
Symbols MTQ2
HEMK2
N6AMT
PRED28
C21orf127
m.HsaHemK2P

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (1)

Gene RIF (5)

AA Sequence

MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLDALEAAAAELAGVEICLEVGSGSGVVSAFLASMIGPQ      1 - 70
ALYMCTDINPEAAACTLETARCNKVHIQPVITDLVKGLLPRLTEKVDLLVFNPPYVVTPPQEVGSHGIEA     71 - 140
AWAGGRNGREVMDRFFPLVPDLLSPRGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLK    141 - 210
FTKS                                                                      211 - 214
//

Text Mined References (12)

PMID Year Title