Property Summary

NCBI Gene PubMed Count 8
PubMed Score 16.01
PubTator Score 7.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Down syndrome 548
Muscle Weakness 92
Disease Target Count P-value
osteosarcoma 7933 3.58862227117184E-6
lung cancer 4473 5.75175687838796E-4

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.232 0.000
lung cancer 1.700 0.001

Synonym

Accession Q9Y5N5 Q96F73
Symbols MTQ2
HEMK2
N6AMT
PRED28
C21orf127
m.HsaHemK2P

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
C. elegans OMA EggNOG
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (4)

PMID Text
23665909 Five N6AMT1 single nucleotide polymorphisms and two N6AMT1 haplotypes were significantly associated with the percentage of methylarsonic acid in urine, even after adjusting for arsenic (+3 oxidation state) methyltransferase haplotype.
21193388 N6AMT1 converted monomethylarsonous acid to dimethylarsonic acid when overexpressed in UROtsa human urothelial cells. It is expressed in many human tissues at variable levels, supporting a potential participation in arsenic metabolism in vivo.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18539146 The human HemK2 protein methylates human and yeast eRF1.eRF3.GTP in vitro, and that the methyltransferase catalytic subunit can complement the growth defect of yeast strains deleted for mtq2.

AA Sequence

MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLNALEAAAAELAGVEICLEVGSGSGVVSAFLASMIGPQ      1 - 70
ALYMCTDINPEAAACTLETARCNKVHIQPVITDLVKGLLPRLTEKVDLLVFNPPYVVTPPQEVGSHGIEA     71 - 140
AWAGGKNGREVMDRFFPLVPDLLSPKGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLK    141 - 210
FTKS                                                                      211 - 214
//

Text Mined References (10)

PMID Year Title
23665909 2013 N-6-adenine-specific DNA methyltransferase 1 (N6AMT1) polymorphisms and arsenic methylation in Andean women.
21269460 2011 Initial characterization of the human central proteome.
21193388 2011 Involvement of N-6 adenine-specific DNA methyltransferase 1 (N6AMT1) in arsenic biomethylation and its role in arsenic-induced toxicity.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18539146 2008 HemK2 protein, encoded on human chromosome 21, methylates translation termination factor eRF1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10830953 2000 The DNA sequence of human chromosome 21.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.