Property Summary

NCBI Gene PubMed Count 16
PubMed Score 3.90
PubTator Score 8.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
active Crohn's disease 1.270 6.8e-03
acute quadriplegic myopathy 1.054 7.7e-06
astrocytic glioma -1.200 2.9e-02
glioblastoma 1.100 8.9e-03
group 3 medulloblastoma 1.300 1.9e-02
interstitial cystitis 1.300 5.6e-04
lung cancer 1.700 3.0e-03
Multiple myeloma 1.139 6.8e-03
non-small cell lung cancer 1.424 4.4e-18
ovarian cancer 2.500 6.0e-05
pancreatic cancer -1.700 2.8e-04
pancreatic ductal adenocarcinoma liver m... -1.220 1.4e-02
pituitary cancer -1.800 4.4e-09

Gene RIF (3)

AA Sequence

MASADSRRVADGGGAGGTFQPYLDTLRQELQQTDPTLLSVVVAVLAVLLTLVFWKLIRSRRSSQRAVLLV      1 - 70
GLCDSGKTLLFVRLLTGLYRDTQTSITDSCAVYRVNNNRGNSLTLIDLPGHESLRLQFLERFKSSARAIV     71 - 140
FVVDSAAFQREVKDVAEFLYQVLIDSMGLKNTPSFLIACNKQDIAMAKSAKLIQQQLEKELNTLRVTRSA    141 - 210
APSTLDSSSTAPAQLGKKGKEFEFSQLPLKVEFLECSAKGGRGDVGSADIQDLEKWLAKIA             211 - 271
//

Text Mined References (20)

PMID Year Title