Property Summary

NCBI Gene PubMed Count 16
PubMed Score 3.54
PubTator Score 8.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Multiple myeloma 1.139 0.007
astrocytic glioma -1.200 0.029
glioblastoma 1.100 0.009
acute quadriplegic myopathy 1.054 0.000
pancreatic ductal adenocarcinoma liver m... -1.658 0.021
non-small cell lung cancer 1.424 0.000
lung cancer 1.700 0.003
active Crohn's disease 1.270 0.007
interstitial cystitis 1.300 0.001
group 3 medulloblastoma 1.300 0.019
ovarian cancer 2.500 0.000
pituitary cancer -1.800 0.000
pancreatic cancer -1.700 0.000

Synonym

Accession Q9Y5M8 Q6P595 Q8N2D8 SR-beta
Symbols APMCF1

Gene

PANTHER Protein Class (1)

Gene RIF (6)

PMID Text
23125841 Tandem affinity purification and mass spectrometry analysis identify signal recognition particle receptor B subunit (SRPRB), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify signal recognition particle receptor B subunit (SRPRB), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify signal recognition particle receptor B subunit (SRPRB), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify signal recognition particle receptor B subunit (SRPRB), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
17080297 APMCF1 participates at least partially in cell cycle regulation through regulating genes such as p21 and TIMP3.
12918107 APMCF1 may be the gene coding human signal recognition particle receptor beta and belongs to the small-G protein superfamily. Its strong expression pattern in colon cancer suggests it may play a role in colon cancer development.

AA Sequence

MASADSRRVADGGGAGGTFQPYLDTLRQELQQTDPTLLSVVVAVLAVLLTLVFWKLIRSRRSSQRAVLLV      1 - 70
GLCDSGKTLLFVRLLTGLYRDTQTSITDSCAVYRVNNNRGNSLTLIDLPGHESLRLQFLERFKSSARAIV     71 - 140
FVVDSAAFQREVKDVAEFLYQVLIDSMGLKNTPSFLIACNKQDIAMAKSAKLIQQQLEKELNTLRVTRSA    141 - 210
APSTLDSSSTAPAQLGKKGKEFEFSQLPLKVEFLECSAKGGRGDVGSADIQDLEKWLAKIA             211 - 271
//

Text Mined References (20)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23264731 2013 MTR120/KIAA1383, a novel microtubule-associated protein, promotes microtubule stability and ensures cytokinesis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22375059 2012 Different effects of Sec61?, Sec62 and Sec63 depletion on transport of polypeptides into the endoplasmic reticulum of mammalian cells.
21665994 2011 Genome-wide association study identifies two loci strongly affecting transferrin glycosylation.
21269460 2011 Initial characterization of the human central proteome.
19664239 2009 Subcellular localization of APMCF1 and its biological significance of expression pattern in normal and malignant human tissues.
19084217 2009 Variants in TF and HFE explain approximately 40% of genetic variation in serum-transferrin levels.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
More...