Property Summary

NCBI Gene PubMed Count 6
PubMed Score 10.21
PubTator Score 3.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 2.4e-04
lung cancer 4740 3.2e-04
Disease Target Count Z-score Confidence
Glaucoma 239 3.595 1.8

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer 1.500 3.2e-04
osteosarcoma 1.319 2.4e-04

Gene RIF (1)

AA Sequence

MGMYPPLLLKIYLSRHISILFYLKILYKSGIIWLSWYSFILLVL                                1 - 44
//

Text Mined References (6)

PMID Year Title