Property Summary

NCBI Gene PubMed Count 6
PubMed Score 9.46
PubTator Score 3.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.319 0.000
lung cancer 1.500 0.000

Synonym

Accession Q9Y5M6 Q4G0F9
Symbols TISR

Gene

 GO Process (1)

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
12655282 There was no evidence that the oculomedin gene participates in the etiology of glaucoma.

AA Sequence

MGMYPPLLLKIYLSRHISILFYLKILYKSGIIWLSWYSFILLVL                                1 - 44
//

Text Mined References (6)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12868032 2003 Protein expression, genomic structure, and polymorphisms of oculomedin.
12655282 2003 Evaluation of the Oculomedin gene in the etiology of primary open angle and exfoliative glaucoma.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11129344 2000 Absence of trabecular meshwork-inducible stretch response (TISR)/oculomedin gene and proximal promoter mutation in primary open angle glaucoma patients.
10362512 1999 A novel gene (oculomedin) induced by mechanical stretching in human trabecular cells of the eye.