Property Summary

NCBI Gene PubMed Count 8
PubMed Score 6.85
PubTator Score 5.58

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MQPRTQPLAQTLPFFLGGAPRDTGLRVPVIKMGTGWEGFQRTLKEVAYILLCCWCIKELLD               1 - 61
//

Text Mined References (9)

PMID Year Title