Property Summary

NCBI Gene PubMed Count 8
PubMed Score 6.96
PubTator Score 5.58

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9Y5L5 B5BUM1 Q5T1A4
Symbols LEP503

Gene

 GO Function (1)

 Compartment GO Term (1)

AA Sequence

MQPRTQPLAQTLPFFLGGAPRDTGLRVPVIKMGTGWEGFQRTLKEVAYILLCCWCIKELLD               1 - 61
//

Publication (9)

PMID Year Title
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
19054851 2008 Human protein factory for converting the transcriptome into an in vitro-expressed proteome,.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11376938 2001 Functional analysis of the promoter and chromosomal localization for human LEP503, a novel lens epithelium gene.
10655141 2000 A novel lens epithelium gene, LEP503, is highly conserved in different vertebrate species and is developmentally regulated in postnatal rat lens.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7641850 1995 Lens epithelial cell mRNA. I. Cloning and sequencing of a messenger RNA with a basic motif/leucine-rich domain specifically expressed in rat lens epithelial cells.