Property Summary

NCBI Gene PubMed Count 16
Grant Count 5
R01 Count 4
Funding $571,590
PubMed Score 16.80
PubTator Score 13.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
esophageal adenocarcinoma -1.500 0.028
psoriasis 1.700 0.000
glioblastoma multiforme 2.000 0.000
osteosarcoma 3.494 0.000
Atopic dermatitis -1.300 0.005
adrenocortical carcinoma 1.554 0.006
tuberculosis and treatment for 3 months -5.400 0.000
primary pancreatic ductal adenocarcinoma 1.976 0.025
non-small cell lung cancer 1.938 0.000
lung cancer 2.600 0.000
colon cancer 1.600 0.016
pancreatic cancer 1.800 0.034
posterior fossa group A ependymoma 1.400 0.001
lung adenocarcinoma 1.100 0.000
Breast cancer 1.800 0.000
ulcerative colitis 1.100 0.000
ovarian cancer 1.300 0.006

Synonym

Accession Q9Y5L2 A4D0Z5 Q52LY5 Q53HJ7
Symbols HIG2
HIG-2
C7orf68

Gene

 GO Function (1)

Gene RIF (7)

PMID Text
24876382 data uncover HILPDA as a novel PPAR target that raises hepatic triglyceride storage via regulation of triglyceride secretion.
23916472 Data indicate that HIG2 (hypoxia-inducible gene 2) is a HIF-1alpha target in regulating cell survival during hypoxia.
23898208 HIV-1 Tat upregulates the expression of hypoxia inducible lipid droplet-associated protein (HILPDA) in human primary T cells
21614900 there was no significant relationship between HIG2 expression and age, clinical stage and histology in either cervical cancer or endometrial cancer.
21124928 Data show that DBN1, SETMAR and HIG2 are direct transcriptional targets of the SOX11 protein.
20624928 HIG2 was up-regulated by hypoxia and HIF inducers in all cell types and mouse organs investigated and abundantly expressed in renal clear-cell carcinomas
20134266 may be used as a marker for early detection of ovarian clear cell adenocarcinoma

AA Sequence

MKHVLNLYLLGVVLTLLSIFVRVMESLEGLLESPSPGTSWTTRSQLANTEPTKGLPDHPSRSM             1 - 63
//

Publication (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24876382 2014 Hypoxia-inducible lipid droplet-associated (HILPDA) is a novel peroxisome proliferator-activated receptor (PPAR) target involved in hepatic triglyceride secretion.
23916472 2013 HIG2 promotes colorectal cancer progression via hypoxia-dependent and independent pathways.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21614900 2011 Expression of hypoxia-inducible 2 (HIG2) protein in uterine cancer.
21124928 2010 Gene expression profiling and chromatin immunoprecipitation identify DBN1, SETMAR and HIG2 as direct targets of SOX11 in mantle cell lymphoma.
20624928 2010 Hypoxia-inducible protein 2 is a novel lipid droplet protein and a specific target gene of hypoxia-inducible factor-1.
20134266 2010 Differential expression of hypoxia-inducible protein 2 among different histological types of epithelial ovarian cancer and in clear cell adenocarcinomas.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18550099 2008 Over expression of hypoxia-inducible protein 2, hypoxia-inducible factor-1alpha and nuclear factor kappaB is putatively involved in acquired renal cyst formation and subsequent tumor transformation in patients with end stage renal failure.
More...