Property Summary

NCBI Gene PubMed Count 59
Grant Count 19
R01 Count 10
Funding $3,018,621.85
PubMed Score 54.46
PubTator Score 50.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis -2.100 0.000
osteosarcoma -2.601 0.000
astrocytoma 1.100 0.005
ovarian cancer 1.200 0.000

Gene RIF (107)

PMID Text
25731773 TNPO3 is an export factor for both HIV-1 CA and tRNAs from the nucleus of infected cells
25517934 TNPO3 is an export factor for both HIV-1 CA and tRNAs from the nucleus of infected cells
25205108 IRF5-TNPO3 genetic variation is associated systemic lupus erythematosus.
25147212 TNPO3 is an export factor for both HIV-1 CA and tRNAs from the nucleus of infected cells
25063804 Data suggest that the HIV-1 integrase (IN)/transportin-SR2 (TRN-SR2) interaction interface is a potential target for antiviral therapy.
25063804 TNPO3 is an export factor for both HIV-1 CA and tRNAs from the nucleus of infected cells
25063804 TNPO3 is an export factor for both HIV-1 CA and tRNAs from the nucleus of infected cells
25063804 TNPO3 is an export factor for both HIV-1 CA and tRNAs from the nucleus of infected cells
25036886 TNPO3 is an export factor for both HIV-1 CA and tRNAs from the nucleus of infected cells
25036886 TNPO3 is an export factor for both HIV-1 CA and tRNAs from the nucleus of infected cells
More...

AA Sequence

MEGAKPTLQLVYQAVQALYHDPDPSGKERASFWLGELQRSVHAWEISDQLLQIRQDVESCYFAAQTMKMK      1 - 70
IQTSFYELPTDSHASLRDSLLTHIQNLKDLSPVIVTQLALAIADLALQMPSWKGCVQTLVEKYSNDVTSL     71 - 140
PFLLEILTVLPEEVHSRSLRIGANRRTEIIEDLAFYSSTVVSLLMTCVEKAGTDEKMLMKVFRCLGSWFN    141 - 210
LGVLDSNFMANNKLLALLFEVLQQDKTSSNLHEAASDCVCSALYAIENVETNLPLAMQLFQGVLTLETAY    211 - 280
HMAVAREDLDKVLNYCRIFTELCETFLEKIVCTPGQGLGDLRTLELLLICAGHPQYEVVEISFNFWYRLG    281 - 350
EHLYKTNDEVIHGIFKAYIQRLLHALARHCQLEPDHEGVPEETDDFGEFRMRVSDLVKDLIFLIGSMECF    351 - 420
AQLYSTLKEGNPPWEVTEAVLFIMAAIAKSVDPENNPTLVEVLEGVVRLPETVHTAVRYTSIELVGEMSE    421 - 490
VVDRNPQFLDPVLGYLMKGLCEKPLASAAAKAIHNICSVCRDHMAQHFNGLLEIARSLDSFLLSPEAAVG    491 - 560
LLKGTALVLARLPLDKITECLSELCSVQVMALKKLLSQEPSNGISSDPTVFLDRLAVIFRHTNPIVENGQ    561 - 630
THPCQKVIQEIWPVLSETLNKHRADNRIVERCCRCLRFAVRCVGKGSAALLQPLVTQMVNVYHVHQHSCF    631 - 700
LYLGSILVDEYGMEEGCRQGLLDMLQALCIPTFQLLEQQNGLQNHPDTVDDLFRLATRFIQRSPVTLLRS    701 - 770
QVVIPILQWAIASTTLDHRDANCSVMRFLRDLIHTGVANDHEEDFELRKELIGQVMNQLGQQLVSQLLHT    771 - 840
CCFCLPPYTLPDVAEVLWEIMQVDRPTFCRWLENSLKGLPKETTVGAVTVTHKQLTDFHKQVTSAEECKQ    841 - 910
VCWALRDFTRLFR                                                             911 - 923
//

Publication (66)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25205108 2015 The IRF5-TNPO3 association with systemic lupus erythematosus has two components that other autoimmune disorders variably share.
25063804 2014 The HIV-1 integrase mutant R263A/K264A is 2-fold defective for TRN-SR2 binding and viral nuclear import.
24871463 2014 GWAS identifies novel SLE susceptibility genes and explains the association of the HLA region.
24449914 2014 Structural basis for nuclear import of splicing factors by human Transportin 3.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23878195 2013 Interaction of transportin-SR2 with Ras-related nuclear protein (Ran) GTPase.
23740937 2013 A systemic sclerosis and systemic lupus erythematosus pan-meta-GWAS reveals new shared susceptibility loci.
23667635 2013 Next-generation sequencing identifies transportin 3 as the causative gene for LGMD1F.
23622145 2013 The ability of TNPO3-depleted cells to inhibit HIV-1 infection requires CPSF6.
More...