Property Summary

NCBI Gene PubMed Count 32
Grant Count 5
R01 Count 5
Funding $1,211,191
PubMed Score 30.22
PubTator Score 4.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Gene RIF (3)

PMID Text
25006744 Top single-nucleotide polymorphism rs9590614 in VMA8 is located within genes that function in cell-cell signaling and cell migration.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSGKDRIEIFPSRMAQTIMKARLKGAQTGRNLLKKKSDALTLRFRQILKKIIETKMLMGEVMREAAFSLA      1 - 70
EAKFTAGDFSTTVIQNVNKAQVKIRAKKDNVAGVTLPVFEHYHEGTDSYELTGLARGGEQLAKLKRNYAK     71 - 140
AVELLVELASLQTSFVTLDEAIKITNRRVNAIEHVIIPRIERTLAYIITELDEREREEFYRLKKIQEKKK    141 - 210
ILKEKSEKDLEQRRAAGEVLEPANLLAEEKDEDLLFE                                     211 - 247
//

Publication (34)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25006744 2014 Genome-wide association identifies regulatory Loci associated with distinct local histogram emphysema patterns.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22982048 2012 Lipofuscin is formed independently of macroautophagy and lysosomal activity in stress-induced prematurely senescent human fibroblasts.
21844891 2012 A SNX10/V-ATPase pathway regulates ciliogenesis in vitro and in vivo.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
More...