Property Summary

NCBI Gene PubMed Count 32
PubMed Score 30.22
PubTator Score 4.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
medulloblastoma 1524 2.64677918877638E-9
osteosarcoma 7933 4.85145029720749E-8
medulloblastoma, large-cell 6234 5.77632419179571E-6
ovarian cancer 8492 3.279988153541E-5
atypical teratoid / rhabdoid tumor 4369 7.84149588860626E-5
glioblastoma 5572 1.1730069970387E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 3.06682778129692E-4
primitive neuroectodermal tumor 3031 4.14560421259629E-4
lung cancer 4473 6.43331914510172E-4
dermatomyositis 967 0.00104630901101294
Waldenstrons macroglobulinemia 765 0.00293051228032751
tuberculosis and treatment for 6 months 686 0.00437488710932882
colon cancer 1475 0.00445026368822787
astrocytic glioma 2241 0.00869167090314674
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0123684295468585
oligodendroglioma 2849 0.030765302750618
Breast cancer 3099 0.033104919097936
ependymoma 2514 0.0370661097748708
Disease Target Count Z-score Confidence
Pulmonary emphysema 34 3.082 1.5

Expression

  Differential Expression (18)

Synonym

Accession Q9Y5K8 B2RE33 Q9Y688 V-ATPase subunit D
Symbols VATD
VMA8
ATP6M

Gene

  Ortholog (14)

Gene RIF (3)

PMID Text
25006744 Top single-nucleotide polymorphism rs9590614 in VMA8 is located within genes that function in cell-cell signaling and cell migration.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSGKDRIEIFPSRMAQTIMKARLKGAQTGRNLLKKKSDALTLRFRQILKKIIETKMLMGEVMREAAFSLA      1 - 70
EAKFTAGDFSTTVIQNVNKAQVKIRAKKDNVAGVTLPVFEHYHEGTDSYELTGLARGGEQLAKLKRNYAK     71 - 140
AVELLVELASLQTSFVTLDEAIKITNRRVNAIEHVIIPRIERTLAYIITELDEREREEFYRLKKIQEKKK    141 - 210
ILKEKSEKDLEQRRAAGEVLEPANLLAEEKDEDLLFE                                     211 - 247
//

Text Mined References (34)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25006744 2014 Genome-wide association identifies regulatory Loci associated with distinct local histogram emphysema patterns.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22982048 2012 Lipofuscin is formed independently of macroautophagy and lysosomal activity in stress-induced prematurely senescent human fibroblasts.
21844891 2012 A SNX10/V-ATPase pathway regulates ciliogenesis in vitro and in vivo.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
More...