Property Summary

NCBI Gene PubMed Count 32
PubMed Score 30.22
PubTator Score 4.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytic glioma -1.600 8.7e-03
atypical teratoid / rhabdoid tumor -1.200 7.8e-05
Breast cancer 2.800 3.3e-02
colon cancer -1.500 4.5e-03
dermatomyositis 1.200 1.0e-03
ependymoma -1.100 3.7e-02
glioblastoma -1.200 1.4e-03
group 4 medulloblastoma -1.300 1.1e-06
intraductal papillary-mucinous adenoma (... 1.200 3.1e-04
intraductal papillary-mucinous neoplasm ... 1.100 1.2e-02
lung cancer -1.600 6.4e-04
medulloblastoma, large-cell -2.000 5.8e-06
oligodendroglioma -1.300 3.1e-02
osteosarcoma -1.764 4.9e-08
ovarian cancer -2.100 1.3e-07
primitive neuroectodermal tumor -1.100 4.1e-04
tuberculosis and treatment for 6 months -1.500 4.4e-03
Waldenstrons macroglobulinemia 1.399 2.9e-03

Gene RIF (3)

AA Sequence

MSGKDRIEIFPSRMAQTIMKARLKGAQTGRNLLKKKSDALTLRFRQILKKIIETKMLMGEVMREAAFSLA      1 - 70
EAKFTAGDFSTTVIQNVNKAQVKIRAKKDNVAGVTLPVFEHYHEGTDSYELTGLARGGEQLAKLKRNYAK     71 - 140
AVELLVELASLQTSFVTLDEAIKITNRRVNAIEHVIIPRIERTLAYIITELDEREREEFYRLKKIQEKKK    141 - 210
ILKEKSEKDLEQRRAAGEVLEPANLLAEEKDEDLLFE                                     211 - 247
//

Text Mined References (34)

PMID Year Title