Property Summary

NCBI Gene PubMed Count 69
Grant Count 392
R01 Count 247
Funding $66,127,767.99
PubMed Score 2469.29
PubTator Score 78.96

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9Y5K6 A6NL34 Q5VYA3 Q9UG97
Symbols CMS

Gene

PANTHER Protein Class (1)

PDB

2FEI   2J6F   2J6K   2J6O   2J7I   3AA6   3LK4   3U23   4WCI   4X1V  

Gene RIF (41)

PMID Text
26519441 Study found a novel association of CD2AP with plasma homocysteine in participants with African ancestry and found a new variant in the candidate gene CBS associated with homocysteine
26296892 discovered novel interaction candidates for CD2AP and characterized subtle yet significant differences in the recognition preferences of its three SH3 domains for c-CBL, ALIX, and RIN3
25887956 CD2-Associated Protein affects Abeta levels and Abeta42/Abeta40 ratio in vitro
25631074 Cellular biotinylated CD2-associated protein (CD2AP) protein is incorporated into HIV-1 Gag virus-like particles
25261582 we present the first demonstration that the purified SH3 domains of the CD2AP/Cin85 protein family are able to directly bind the p53 protein, and to discriminate between the two polymorphic variants P72R
25092125 CD2AP rs9349407 polymorphism contributes to Alzheimer's disease susceptibility.
24322428 FSGS3/CD2AP has a role of barbed-end capping in junctional actin dynamics.
23681557 CD2AP gene variants may contribute to susceptibility to end-stage renal disease in patients with type 1 diabetes.
23279575 an FRS2beta-CIN85/CD2AP-Cbl axis for downregulation of ErbB2 may regulate ErbB2 protein levels in physiological and pathological settings
22880102 E2F1 up-regulates the human CD2AP promoter.
More...

AA Sequence

MVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRETEFKDDSLPI      1 - 70
KRERHGNVASLVQRISTYGLPAGGIQPHPQTKNIKKKTKKRQCKVLFEYIPQNEDELELKVGDIIDINEE     71 - 140
VEEGWWSGTLNNKLGLFPSNFVKELEVTDDGETHEAQDDSETVLAGPTSPIPSLGNVSETASGSVTQPKK    141 - 210
IRGIGFGDIFKEGSVKLRTRTSSSETEEKKPEKPLILQSLGPKTQSVEITKTDTEGKIKAKEYCRTLFAY    211 - 280
EGTNEDELTFKEGEIIHLISKETGEAGWWRGELNGKEGVFPDNFAVQINELDKDFPKPKKPPPPAKAPAP    281 - 350
KPELIAAEKKYFSLKPEEKDEKSTLEQKPSKPAAPQVPPKKPTPPTKASNLLRSSGTVYPKRPEKPVPPP    351 - 420
PPIAKINGEVSSISSKFETEPVSKLKLDSEQLPLRPKSVDFDSLTVRTSKETDVVNFDDIASSENLLHLT    421 - 490
ANRPKMPGRRLPGRFNGGHSPTHSPEKILKLPKEEDSANLKPSELKKDTCYSPKPSVYLSTPSSASKANT    491 - 560
TAFLTPLEIKAKVETDDVKKNSLDELRAQIIELLCIVEALKKDHGKELEKLRKDLEEEKTMRSNLEMEIE    561 - 630
KLKKAVLSS                                                                 631 - 639
//

Text Mined References (83)

PMID Year Title
26519441 2016 Genetic Influences on Plasma Homocysteine Levels in African Americans and Yoruba Nigerians.
26296892 2015 Differential Recognition Preferences of the Three Src Homology 3 (SH3) Domains from the Adaptor CD2-associated Protein (CD2AP) and Direct Association with Ras and Rab Interactor 3 (RIN3).
25887956 2015 Effects of CD2-associated protein deficiency on amyloid-? in neuroblastoma cells and in an APP transgenic mouse model.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25261582 2015 The adapter protein CD2AP binds to p53 protein in the cytoplasm and can discriminate its polymorphic variants P72R.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25092125 2015 Analyzing 54,936 Samples Supports the Association Between CD2AP rs9349407 Polymorphism and Alzheimer's Disease Susceptibility.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24322428 2013 FSGS3/CD2AP is a barbed-end capping protein that stabilizes actin and strengthens adherens junctions.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...