Property Summary

NCBI Gene PubMed Count 13
Grant Count 3
Funding $75,316.8
PubMed Score 28.32
PubTator Score 247.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.073 0.005
group 4 medulloblastoma -1.900 0.000
medulloblastoma, large-cell -1.900 0.001
pituitary cancer 2.200 0.000
facioscapulohumeral dystrophy 2.100 0.006

Synonym

Accession Q9Y5K3 A8IX00 B2RCX8 B4DK10 E9PD84 O60621 Q86XC9
Symbols CTB
CCTB

Gene

PANTHER Protein Class (2)

Gene RIF (5)

PMID Text
26165797 CCT contributes to phospholipid compositional homeostasis. [Review]
25452470 PCYT1B, a placental-specific enzyme post-translationally modifying neurokinin B, is essential for the pathogenic role of CRP in preeclampsia through activation of the neurokinin 3 receptor.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19595683 Human phosphate cytidylyltransferase 1, choline, beta is a novel CaOx crystal growth inhibitor.

AA Sequence

MPVVTTDAESETGIPKSLSNEPPSETMEEIEHTCPQPRLTLTAPAPFADETNCQCQAPHEKLTIAQARLG      1 - 70
TPADRPVRVYADGIFDLFHSGHARALMQAKTLFPNSYLLVGVCSDDLTHKFKGFTVMNEAERYEALRHCR     71 - 140
YVDEVIRDAPWTLTPEFLEKHKIDFVAHDDIPYSSAGSDDVYKHIKEAGMFVPTQRTEGISTSDIITRIV    141 - 210
RDYDVYARRNLQRGYTAKELNVSFINEKRYRFQNQVDKMKEKVKNVEERSKEFVNRVEEKSHDLIQKWEE    211 - 280
KSREFIGNFLELFGPDGAWKQMFQERSSRMLQALSPKQSPVSSPTRSRSPSRSPSPTFSWLPLKTSPPSS    281 - 350
PKAASASISSMSEGDEDEK                                                       351 - 369
//

Text Mined References (15)

PMID Year Title
26165797 2015 CTP:phosphocholine cytidylyltransferase: Function, regulation, and structure of an amphitropic enzyme required for membrane biogenesis.
25452470 2015 Neurokinin 3 receptor and phosphocholine transferase: missing factors for pathogenesis of C-reactive protein in preeclampsia.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19595683 2009 Mass spectrometric identification of human phosphate cytidylyltransferase 1 as a novel calcium oxalate crystal growth inhibitor purified from human renal stone matrix.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11580270 2001 Analysis of the interaction between the eukaryotic chaperonin CCT and its substrates actin and tubulin.
10480912 1999 Distribution of CTP:phosphocholine cytidylyltransferase (CCT) isoforms. Identification of a new CCTbeta splice variant.
10409428 1999 Gene expression in proliferating human erythroid cells.
9593753 1998 Cloning and characterization of a second human CTP:phosphocholine cytidylyltransferase.