Property Summary

NCBI Gene PubMed Count 13
PubMed Score 28.77
PubTator Score 247.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Arthritis, Juvenile 126 0.0 0.0
Disease Target Count
Juvenile arthritis 126
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (5)

Disease log2 FC p
facioscapulohumeral dystrophy 2.100 5.7e-03
group 3 medulloblastoma -1.700 4.9e-04
medulloblastoma, large-cell -1.900 1.4e-03
osteosarcoma -1.073 5.3e-03
pituitary cancer 1.400 5.8e-06

Gene RIF (5)

AA Sequence

MPVVTTDAESETGIPKSLSNEPPSETMEEIEHTCPQPRLTLTAPAPFADETNCQCQAPHEKLTIAQARLG      1 - 70
TPADRPVRVYADGIFDLFHSGHARALMQAKTLFPNSYLLVGVCSDDLTHKFKGFTVMNEAERYEALRHCR     71 - 140
YVDEVIRDAPWTLTPEFLEKHKIDFVAHDDIPYSSAGSDDVYKHIKEAGMFVPTQRTEGISTSDIITRIV    141 - 210
RDYDVYARRNLQRGYTAKELNVSFINEKRYRFQNQVDKMKEKVKNVEERSKEFVNRVEEKSHDLIQKWEE    211 - 280
KSREFIGNFLELFGPDGAWKQMFQERSSRMLQALSPKQSPVSSPTRSRSPSRSPSPTFSWLPLKTSPPSS    281 - 350
PKAASASISSMSEGDEDEK                                                       351 - 369
//

Text Mined References (15)

PMID Year Title