Property Summary

Ligand Count 7
NCBI Gene PubMed Count 68
PubMed Score 4527.45
PubTator Score 1338.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma -1.100 3.0e-02
medulloblastoma, large-cell 1.100 1.3e-04
osteosarcoma 2.420 2.7e-10
ovarian cancer 1.600 4.1e-08

Gene RIF (49)

AA Sequence

MATAGNPWGWFLGYLILGVAGSLVSGSCSQIINGEDCSPHSQPWQAALVMENELFCSGVLVHPQWVLSAA      1 - 70
HCFQNSYTIGLGLHSLEADQEPGSQMVEASLSVRHPEYNRPLLANDLMLIKLDESVSESDTIRSISIASQ     71 - 140
CPTAGNSCLVSGWGLLANGRMPTVLQCVNVSVVSEEVCSKLYDPLYHPSMFCAGGGHDQKDSCNGDSGGP    141 - 210
LICNGYLQGLVSFGKAPCGQVGVPGVYTNLCKFTEWIEKTVQAS                              211 - 254
//

Text Mined References (69)

PMID Year Title