Property Summary

NCBI Gene PubMed Count 62
Grant Count 451
R01 Count 276
Funding $63,515,754.24
PubMed Score 4453.11
PubTator Score 1338.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma 2.420 0.000
medulloblastoma, large-cell 1.100 0.000
group 3 medulloblastoma -1.100 0.030
ovarian cancer 1.600 0.000

Synonym

Accession Q9Y5K2 Q4VB16 Q96RU5 Q9GZL6 Q9UBJ6
Symbols ARM1
EMSP
PSTS
AI2A1
EMSP1
KLK-L1
PRSS17
kallikrein

Gene

PDB

2BDG   2BDH   2BDI   4K1E   4K8Y   4KEL   4KGA  

Gene RIF (43)

PMID Text
26420451 Studied a 70-kb region surrounding KLK4 in East Asian population; found within combined unusual low levels of diversity, high frequency variants with significant levels of population differentiation.
26124219 Novel homozygous mutations in the KLK4 (c.620_621delCT, p.Ser207Trpfs*38) were identified in amelogenesis imperfecta consanguinity. Mutant KLK4 was degraded intracellularly and became inactive.
25862839 this study provides supportive evidence in favor of a prognostic value for KLK4 in OSCC and suggests that KLK4 could serve as a potential therapeutic target in patients with oral cancer.
25724897 Human ephrin-B2 is poorly cleaved by KLK4 while the homologous mouse is not.
25563717 secreted into the extracellular microenvironment by neutrophils stimulated with bioactive mediators
25153393 The differential regulation of alternative transcripts (using KLK2, KLK3 and KLK4 as models) by androgens and anti-androgens as an indicator of prostate cancers, was investigated.
25153390 miR-378 was predicted to target both KLK2 and KLK4 and downregulated levels detected in prostate cancer patients.
24854539 KLK4 mRNA positivity could be regarded as a novel independent indicator of favorable prognosis for the disease-free survival of laryngeal squamous cell carcinoma patients.
24405067 The variant rs1722561 of Kallikreins might reduce the risk of sporadic intracranial aneurysms among individuals of Chinese Han ethnicity.
23867815 HIV-1 gp120-treated vaginal epithelial cells show downregulation of kallikrein-related peptidase 4 (KLK4) expression as compared to untreated control
More...

AA Sequence

MATAGNPWGWFLGYLILGVAGSLVSGSCSQIINGEDCSPHSQPWQAALVMENELFCSGVLVHPQWVLSAA      1 - 70
HCFQNSYTIGLGLHSLEADQEPGSQMVEASLSVRHPEYNRPLLANDLMLIKLDESVSESDTIRSISIASQ     71 - 140
CPTAGNSCLVSGWGLLANGRMPTVLQCVNVSVVSEEVCSKLYDPLYHPSMFCAGGGHDQKDSCNGDSGGP    141 - 210
LICNGYLQGLVSFGKAPCGQVGVPGVYTNLCKFTEWIEKTVQAS                              211 - 254
//

Text Mined References (63)

PMID Year Title
26420451 2016 Adaptive Evolution Favoring KLK4 Downregulation in East Asians.
26124219 2015 Novel MMP20 and KLK4 Mutations in Amelogenesis Imperfecta.
25862839 2015 Clinical significance of kallikrein-related peptidase-4 in oral cancer.
25724897 2015 Murine, but not human, ephrin-B2 can be efficiently cleaved by the serine protease kallikrein-4: implications for xenograft models of human prostate cancer.
25563717 2015 Expression and bioregulation of the kallikrein-related peptidases family in the human neutrophil.
25416956 2014 A proteome-scale map of the human interactome network.
25153393 2014 Analysis of androgen and anti-androgen regulation of KLK-related peptidase 2, 3, and 4 alternative transcripts in prostate cancer.
25153390 2014 Loss of miR-378 in prostate cancer, a common regulator of KLK2 and KLK4, correlates with aggressive disease phenotype and predicts the short-term relapse of the patients.
24854539 2014 Low mRNA expression levels of kallikrein-related peptidase 4 (KLK4) predict short-term relapse in patients with laryngeal squamous cell carcinoma.
24405067 2014 Association of Kallikrein gene polymorphisms with sporadic intracranial aneurysms in the Chinese population.
More...