Property Summary

NCBI Gene PubMed Count 16
PubMed Score 208.86
PubTator Score 42.69

Knowledge Summary

Patent

No data available

TINX Plot

Gene RIF (10)

AA Sequence

MAFAPMGPEASFFDVLDRHRESLLAALRRGGREPPTGGSRLASSSEVLASIENIIQDIITSLARNEAPAF      1 - 70
TIDNRSSWENIKFEDSVGLQMVSHCTTRKIKSDSPKSAQKFSLILKILSMIYKLVQSNTYATKRDIYYTD     71 - 140
SQLFGNQTVVDNIINDISCMLKVSRRSLHILSTSKGLIAGNLRYIEEDGTKVNCTCGATAVAVPSNIQGI    141 - 210
RNLVTDAKFVLIVEKDATFQRLLDDNFCNKLSPCIMITGKGVPDLNTRLLVKKLWDTFHVPVFTLVDADP    211 - 280
HGIEIMCIYKYGSMSMSFEAHHLTVPAIRWLGLLPSDLKRLNVPKDSLIPLTKRDQMKLDSILRRPYVTC    281 - 350
QPFWRKEMEIMADSKMKAEIQALTFLSSDYLSRVYLPNKLKFGGWI                            351 - 396
//

Text Mined References (16)

PMID Year Title