Property Summary

NCBI Gene PubMed Count 15
Grant Count 85
R01 Count 62
Funding $11,632,188.43
PubMed Score 203.01
PubTator Score 42.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Synonym

Accession Q9Y5K1 Q5TCI1 Q8N4V0 Q9NQM7 Q9NQM8
Symbols CT35
TOPVIA
SPATA43

Gene

Gene RIF (9)

PMID Text
26663067 Data suggest that the combined genotypes of glutathionine S-transferase GSTM1 (-/-), GSTT1 (+/+), GSTP1 (AA) and meiotic recombination protein SPO11 (CT) may be associated with idiopathic male infertility in ethnic Han Chinese.
25005169 Polymorphisms within the SPO11 gene are linked to the susceptibility of azoospermia and oligozoospermia male infertility.
21556891 SPO11 might has an effect on premorbid functioning, which increase susceptibility for idiopathic male reproduction
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20378615 Observational study of gene-disease association. (HuGE Navigator)
18166824 Data show that there is no association between SPO11 gene mutation and premature ovarian failure.
18166824 Observational study of gene-disease association. (HuGE Navigator)
16169419 Observational study of gene-disease association. (HuGE Navigator)
16169419 Mutations in the human SPO11 gene are not common causes of infertility in man

AA Sequence

MAFAPMGPEASFFDVLDRHRESLLAALRRGGREPPTGGSRLASSSEVLASIENIIQDIITSLARNEAPAF      1 - 70
TIDNRSSWENIKFEDSVGLQMVSHCTTRKIKSDSPKSAQKFSLILKILSMIYKLVQSNTYATKRDIYYTD     71 - 140
SQLFGNQTVVDNIINDISCMLKVSRRSLHILSTSKGLIAGNLRYIEEDGTKVNCTCGATAVAVPSNIQGI    141 - 210
RNLVTDAKFVLIVEKDATFQRLLDDNFCNKLSPCIMITGKGVPDLNTRLLVKKLWDTFHVPVFTLVDADP    211 - 280
HGIEIMCIYKYGSMSMSFEAHHLTVPAIRWLGLLPSDLKRLNVPKDSLIPLTKRDQMKLDSILRRPYVTC    281 - 350
QPFWRKEMEIMADSKMKAEIQALTFLSSDYLSRVYLPNKLKFGGWI                            351 - 396
//

Text Mined References (15)

PMID Year Title
26995551 2016 A new light on the meiotic DSB catalytic complex.
26917763 2016 A DNA topoisomerase VI-like complex initiates meiotic recombination.
26663067 2015 [Association of SPO11 and GST gene polymorphisms with idiopathic male infertility in ethnic Han Chinese].
25005169 2014 Study of single nucleotide polymorphism (rs28368082) in SPO11 gene and its association with male infertility.
21556891 2011 An association study of SPO11 gene single nucleotide polymorphisms with idiopathic male infertility in Chinese Han population.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20378615 2010 Evaluation of 172 candidate polymorphisms for association with oligozoospermia or azoospermia in a large cohort of men of European descent.
18166824 2008 Genetic investigation of four meiotic genes in women with premature ovarian failure.
16169419 2005 Screening the SPO11 and EIF5A2 genes in a population of infertile men.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...