Property Summary

NCBI Gene PubMed Count 11
PubMed Score 28.61
PubTator Score 7.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Gene RIF (4)

AA Sequence

MAELGEADEAELQRLVAAEQQKAQFTAQVHHFMELCWDKCVEKPGNRLDSRTENCLSSCVDRFIDTTLAI      1 - 70
TSRFAQIVQKGGQ                                                              71 - 83
//

Text Mined References (17)

PMID Year Title