Property Summary

NCBI Gene PubMed Count 12
PubMed Score 21.29
PubTator Score 11.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
diabetes mellitus -1.300 1.5e-03
lung cancer 2.300 1.5e-02
Multiple myeloma 1.044 9.1e-03
osteosarcoma -1.443 3.8e-05
ovarian cancer -1.100 7.2e-04

Gene RIF (3)

AA Sequence

MAAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMTQRISMRFQEY      1 - 70
HIQQNEALAAKAGLLGQPR                                                        71 - 89
//

Text Mined References (16)

PMID Year Title