Property Summary

NCBI Gene PubMed Count 12
PubMed Score 21.73
PubTator Score 11.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 3.80830669318454E-5
ovarian cancer 8492 7.17586756706804E-4
diabetes mellitus 1663 0.00152712125302838
Multiple myeloma 1328 0.00906123175034481
lung cancer 4473 0.0151953595619126
Disease Target Count Z-score Confidence
Deafness dystonia syndrome 20 5.457 2.7
Dystonia 77 3.567 1.8
Barth syndrome 23 3.2 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.044 0.009
osteosarcoma -1.443 0.000
lung cancer 2.300 0.015
diabetes mellitus -1.300 0.002
ovarian cancer -1.100 0.001

Synonym

Accession Q9Y5J7 B2R584
Symbols TIM9
TIM9A

Gene

PDB

2BSK  

  Ortholog (15)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (3)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
16387659 The crystal structure of TIM9.10 described here reveals a previously undescribed alpha-propeller topology in which helical "blades" radiate from a narrow central pore lined with polar residues.
14726512 in contrast to yeast, only a small fraction of Tim9-Tim10a-Tim10b complex is in a stable association with Tim22

AA Sequence

MAAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMTQRISMRFQEY      1 - 70
HIQQNEALAAKAGLLGQPR                                                        71 - 89
//

Text Mined References (16)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23172368 2012 Mitochondria "fuel" breast cancer metabolism: fifteen markers of mitochondrial biogenesis label epithelial cancer cells, but are excluded from adjacent stromal cells.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16387659 2006 Crystal structure of the mitochondrial chaperone TIM9.10 reveals a six-bladed alpha-propeller.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14726512 2004 Organization and function of the small Tim complexes acting along the import pathway of metabolite carriers into mammalian mitochondria.
More...